PDB entry 5jla

View 5jla on RCSB PDB site
Description: Crystal Structure of Ribose-5-phosphate Isomerase from Brucella melitensis 16M
Class: isomerase
Keywords: alpha-beta-alpha, isomerase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2016-04-26, released 2016-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative short-chain dehydrogenase/reductase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_C0850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jlaa_
  • Chain 'B':
    Compound: putative short-chain dehydrogenase/reductase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_C0850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jlab_
  • Chain 'C':
    Compound: putative short-chain dehydrogenase/reductase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_C0850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jlac_
  • Chain 'D':
    Compound: putative short-chain dehydrogenase/reductase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_C0850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jlad_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jlaA (A:)
    mahhhhhhmtasaefngaiavvtgagsgigracaellsrsganvivadrdieaatrvara
    tggktlvldvgedasvtaaanevrarygvadvlvncagvlqrtlppgelaqrewdvvsri
    dlrgtylccaafgapmadrrrgsivniasvagmrsgplhaygpakagvisltetlagewg
    pkgvrvncvspgftqtpalergftthtlkadvlrdaaalghivsaneiaeavvflasera
    saitgvnlpvdagyliagswaaygglrresagqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jlaA (A:)
    asaefngaiavvtgagsgigracaellsrsganvivadrdieaatrvaratggktlvldv
    gedasvtaaanevrarygvadvlvncagvlqrtlppgelaqrewdvvsridlrgtylcca
    afgapmadrrrgsivniasvagmrsgplhaygpakagvisltetlagewgpkgvrvncvs
    pgftqtpalergfttlkadvlrdaaalghivsaneiaeavvflaserasaitgvnlpvda
    gyliagswaaygglrre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jlaB (B:)
    mahhhhhhmtasaefngaiavvtgagsgigracaellsrsganvivadrdieaatrvara
    tggktlvldvgedasvtaaanevrarygvadvlvncagvlqrtlppgelaqrewdvvsri
    dlrgtylccaafgapmadrrrgsivniasvagmrsgplhaygpakagvisltetlagewg
    pkgvrvncvspgftqtpalergftthtlkadvlrdaaalghivsaneiaeavvflasera
    saitgvnlpvdagyliagswaaygglrresagqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jlaB (B:)
    asaefngaiavvtgagsgigracaellsrsganvivadrdieaatrvaratggktlvldv
    gedasvtaaanevrarygvadvlvncagvlqrtlppgelaqrewdvvsridlrgtylcca
    afgapmadrrrgsivniasvagmrsgplhaygpakagvisltetlagewgpkgvrvncvs
    pgftqtpalergftthtlkadvlrdaaalghivsaneiaeavvflaserasaitgvnlpv
    dagyliagswaaygglrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jlaC (C:)
    mahhhhhhmtasaefngaiavvtgagsgigracaellsrsganvivadrdieaatrvara
    tggktlvldvgedasvtaaanevrarygvadvlvncagvlqrtlppgelaqrewdvvsri
    dlrgtylccaafgapmadrrrgsivniasvagmrsgplhaygpakagvisltetlagewg
    pkgvrvncvspgftqtpalergftthtlkadvlrdaaalghivsaneiaeavvflasera
    saitgvnlpvdagyliagswaaygglrresagqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jlaC (C:)
    asaefngaiavvtgagsgigracaellsrsganvivadrdieaatrvaratggktlvldv
    gedasvtaaanevrarygvadvlvncagvlqrtlppgelaqrewdvvsridlrgtylcca
    afgapmadrrrgsivniasvagmrsgplhaygpakagvisltetlagewgpkgvrvncvs
    pgftqtpalergftthtlkadvlrdaaalghivsaneiaeavvflaserasaitgvnlpv
    dagyliagswaaygglrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5jlaD (D:)
    mahhhhhhmtasaefngaiavvtgagsgigracaellsrsganvivadrdieaatrvara
    tggktlvldvgedasvtaaanevrarygvadvlvncagvlqrtlppgelaqrewdvvsri
    dlrgtylccaafgapmadrrrgsivniasvagmrsgplhaygpakagvisltetlagewg
    pkgvrvncvspgftqtpalergftthtlkadvlrdaaalghivsaneiaeavvflasera
    saitgvnlpvdagyliagswaaygglrresagqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jlaD (D:)
    asaefngaiavvtgagsgigracaellsrsganvivadrdieaatrvaratggktlvldv
    gedasvtaaanevrarygvadvlvncagvlqrtlppgelaqrewdvvsridlrgtylcca
    afgapmadrrrgsivniasvagmrsgplhaygpakagvisltetlagewgpkgvrvncvs
    pgftqtpalergftthtlkadvlrdaaalghivsaneiaeavvflaserasaitgvnlpv
    dagyliagswaaygglrre