PDB entry 5jkq

View 5jkq on RCSB PDB site
Description: crystal structure of plasmodium falciparum pf3d7_0606800 (pfvft1)
Deposited on 2016-04-26, released 2017-07-19
The last revision was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PfVFT1
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PFF0335c
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6KSR6 (4-280)
      • expression tag (3)
      • engineered mutation (12)
      • engineered mutation (56)
      • engineered mutation (127)
      • expression tag (281-283)
  • Chain 'B':
    Compound: PfVFT1
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PFF0335c
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6KSR6 (4-280)
      • expression tag (1-3)
      • engineered mutation (12)
      • engineered mutation (56)
      • engineered mutation (127)
      • expression tag (281-283)
  • Chain 'C':
    Compound: PfVFT1
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PFF0335c
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6KSR6 (4-280)
      • expression tag (3)
      • engineered mutation (12)
      • engineered mutation (56)
      • engineered mutation (127)
      • expression tag (281-283)
  • Chain 'D':
    Compound: PfVFT1
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PFF0335c
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6KSR6 (Start-280)
      • engineered mutation (12)
      • engineered mutation (56)
      • engineered mutation (127)
      • expression tag (281-282)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jkqA (A:)
    gsmgveevvnnkakrlidiyhaavkeliqneelidlidkhnvdysviesienlpnladin
    vkddiddvlseiikkkevkigalknknwgiignyeqnppvgfwpdvmyiiwetiskhifn
    dedainiaynyydnvfvalndkdihmtdnyflsnsrlvdqsgnnlpkltsglpiikhsnk
    imilkeyninnledlksyiskneglkiaclteancnalknifldkvtydyksfssyidls
    ksvlskshiigvisgipfnfnehkinvfdsflktghsayfkaaa
    

    Sequence, based on observed residues (ATOM records):
    >5jkqA (A:)
    gveevvnnkakrlidiyhaavkeliqneelidlidkhnvdysviesienlpnladinvkd
    diddvlseiikkkevkigalknknwgiignyeqnppvgfwpdvmyiiwetiskhifnded
    ainiaynyydnvfvalndkdihmtdnyflsnsrlvdqsgnnlpkltsglpiikhsnkimi
    lkeyninnledlksyiskneglkiaclteancnalknifldkvtydyksfssyidlsksv
    lskshiigvisgipfnfnehkinvfdsflktghsayfkaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jkqB (B:)
    gsmgveevvnnkakrlidiyhaavkeliqneelidlidkhnvdysviesienlpnladin
    vkddiddvlseiikkkevkigalknknwgiignyeqnppvgfwpdvmyiiwetiskhifn
    dedainiaynyydnvfvalndkdihmtdnyflsnsrlvdqsgnnlpkltsglpiikhsnk
    imilkeyninnledlksyiskneglkiaclteancnalknifldkvtydyksfssyidls
    ksvlskshiigvisgipfnfnehkinvfdsflktghsayfkaaa
    

    Sequence, based on observed residues (ATOM records):
    >5jkqB (B:)
    smgveevvnnkakrlidiyhaavkeliqneelidlidkhnvdysviesienlpnladinv
    kddiddvlseiikkkevkigalknknwgiignyeqnppvgfwpdvmyiiwetiskhifnd
    edainiaynyydnvfvalndkdihmtdnyflsnsrlvdsgnnlpkltsglpiikhsnkim
    ilkeyninnledlksyiskneglkiaclteancnalknifldkvtydyksfssyidlsks
    vlskshiigvisgipfnfnehkinvfdsflktghsayfkaaa
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jkqC (C:)
    gsmgveevvnnkakrlidiyhaavkeliqneelidlidkhnvdysviesienlpnladin
    vkddiddvlseiikkkevkigalknknwgiignyeqnppvgfwpdvmyiiwetiskhifn
    dedainiaynyydnvfvalndkdihmtdnyflsnsrlvdqsgnnlpkltsglpiikhsnk
    imilkeyninnledlksyiskneglkiaclteancnalknifldkvtydyksfssyidls
    ksvlskshiigvisgipfnfnehkinvfdsflktghsayfkaaa
    

    Sequence, based on observed residues (ATOM records):
    >5jkqC (C:)
    gveevvnnkakrlidiyhaavkeliqneelidlidkhnvdysviesienlpnladinvkd
    diddvlseiikkkevkigalknknwgiignyeqnppvgfwpdvmyiiwetiskhifnded
    ainiaynyydnvfvalndkdihmtdnyflsnnnlpkltsglpiikhsnkimilkeyninn
    ledlksyiskneglkiaclteancnalknifldkvtydyksfssyidlsksvlskshiig
    visgipfnfnehkinvfdsflktghsayfkaaa
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jkqD (D:)
    gsmgveevvnnkakrlidiyhaavkeliqneelidlidkhnvdysviesienlpnladin
    vkddiddvlseiikkkevkigalknknwgiignyeqnppvgfwpdvmyiiwetiskhifn
    dedainiaynyydnvfvalndkdihmtdnyflsnsrlvdqsgnnlpkltsglpiikhsnk
    imilkeyninnledlksyiskneglkiaclteancnalknifldkvtydyksfssyidls
    ksvlskshiigvisgipfnfnehkinvfdsflktghsayfkaaa
    

    Sequence, based on observed residues (ATOM records):
    >5jkqD (D:)
    kakrlidiyhaavkeliqneelidlidkhnvdysviesienlpnladinvkddiddvlse
    iikkkevkigalknknwgiignyeqnppvgfwpdvmyiiwetiskhifndedainiayny
    ydnvfvalndkdihmtdnyflsnslpkltsglpiikhsnkimilkeyninnledlksyis
    kneglkiaclteancnalknifldkvtydyksfssyidlsksvlskshiigvisgipfnf
    nehkinvfdsflktghsayfkaa