PDB entry 5jkn

View 5jkn on RCSB PDB site
Description: crystal structure of deubiquitinase mindy-1
Deposited on 2016-04-26, released 2016-06-22
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein FAM63A
    Species: Homo sapiens [TaxId:9606]
    Gene: FAM63A, KIAA1390
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PEG, PO4, HG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jknA (A:)
    gplgspefpgrlemepdfycvkwipwkgeqtpiitqstngpcpllaimnilflqwkvklp
    pqkevitsdelmahlgncllsikpqekseglqlnfqqnvddamtvlpklatgldvnvrft
    gvsdfeytpecsvfdllgiplyhgwlvdpqspeavravgklsynqlveriitckhssdtn
    lvtegliaeqflettaaqltyhglceltaaakegelsvffrnnhfstmtkhkshlyllvt
    dqgflqeeqvvweslhnvdgdscfcdsdfhlshslgkgpgaeggsgspe
    

    Sequence, based on observed residues (ATOM records):
    >5jknA (A:)
    pdfycvkwipwkgeqtpiitqstngpcpllaimnilflqwkvklppqkevitsdelmahl
    gncllsikpqeglqlnfqqnvddamtvlpklatgldvnvrftgvsdfeytpecsvfdllg
    iplyhgwlvdpqspeavravgklsynqlveriitckhssdtnlvtegliaeqflettaaq
    ltyhglceltaaakegelsvffrnnhfstmtkhkshlyllvtdqgflqeeqvvweslhnv
    dgdscfcdsdfhlshs