PDB entry 5jka

View 5jka on RCSB PDB site
Description: crystal structure of human juno (crystal form 1)
Deposited on 2016-04-26, released 2016-06-22
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sperm-egg fusion protein Juno
    Species: Homo sapiens [TaxId:9606]
    Gene: IZUMO1R, FOLR4, JUNO
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6ND01 (4-212)
      • expression tag (3)
      • expression tag (213-215)
  • Chain 'B':
    Compound: Sperm-egg fusion protein Juno
    Species: Homo sapiens [TaxId:9606]
    Gene: IZUMO1R, FOLR4, JUNO
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6ND01 (4-212)
      • expression tag (213-215)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jkaA (A:)
    rspwgdellnicmnakhhkrvpspedklyeecipwkdnacctlttsweahldvsplynfs
    lfhcgllmpgcrkhfiqaicfyecspnlgpwiqpvgslgwevapsgqgervvnvplcqed
    ceewwedcrmsytcksnwrggwdwsqgknrcpkgaqclpfshyfptpadlcektwsnsfk
    asperrnsgrclqkwfepaqgnpnvavarlfaseflevlfq
    

    Sequence, based on observed residues (ATOM records):
    >5jkaA (A:)
    wgdellnicmnakhhkrvpspedklyeecipwkdnacctlttsweahldvsplynfslfh
    cgllmpgcrkhfiqaicfyecspnlgpwiqpgervvnvplcqedceewwedcrmsytcks
    nwrggwdwsqgknrcpkgaqclpfshyfptpadlcektwsnsfkasperrnsgrclqkwf
    epaqgnpnvavarlfasefl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jkaB (B:)
    rspwgdellnicmnakhhkrvpspedklyeecipwkdnacctlttsweahldvsplynfs
    lfhcgllmpgcrkhfiqaicfyecspnlgpwiqpvgslgwevapsgqgervvnvplcqed
    ceewwedcrmsytcksnwrggwdwsqgknrcpkgaqclpfshyfptpadlcektwsnsfk
    asperrnsgrclqkwfepaqgnpnvavarlfaseflevlfq
    

    Sequence, based on observed residues (ATOM records):
    >5jkaB (B:)
    gdellnicmnakhhkrvpspedklyeecipwkdnacctlttsweahldvsplynfslfhc
    gllmpgcrkhfiqaicfyecspnlgpwiqpgervvnvplcqedceewwedcrmsytcksn
    wrggwdwsqgknrcpkgaqclpfshyfptpadlcektwsnsfkasperrnsgrclqkwfe
    paqgnpnvavarlfasefl