PDB entry 5jk8

View 5jk8 on RCSB PDB site
Description: phenylalanine hydroxylase from dictyostelium - bh2, norleucine complex
Deposited on 2016-04-26, released 2017-05-03
The last revision was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylalanine-4-hydroxylase
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: pah, DDB_G0278781
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: phenylalanine-4-hydroxylase
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: pah, DDB_G0278781
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PIN, HBI, FE, NLE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jk8A (A:)
    mgsshhhhhhssglvprgshmasmesntnsqgqgiipqsyhssiffsiskgsdkigglle
    yleiikkhninitriesrpsktekkdydffldleyptennkevekvikdleekgvkattl
    qessnqtyapwfprkisdldlfankvlemgsdltsdhpgasdpvyrerrreiakiastyk
    hgdeipridyteeeiktwgvvynrlkelfptnachqhayifplleqncgyspdnipqlqd
    isnflqectgwrirpvqgllsardflnglafrvfhatqyirhpsvplytpepdcchellg
    hvplladpdfadfsqeiglasigasdediqllstcywftvefglckegdtiraygagils
    stgemehfltdkakklpfnpfdacnteypittfqplyyvaesfqkakeqmrqfadsfkkp
    fsirynpytqsieildnk
    

    Sequence, based on observed residues (ATOM records):
    >5jk8A (A:)
    qsyhssiffsiskgsdkigglleyleiikkhninitriesrpsktekkdydffldleypt
    ennkevekvikdleekgvkattlqessnqtyapwfprkisdldlfankvlepgasdpvyr
    errreiakiastykhgdeipridyteeeiktwgvvynrlkelfptnachqhayifplleq
    ncgyspdnipqlqdisnflqectgwrirpvqgllsardflnglafrvfhatqyirhpsvp
    lytpepdcchellghvplladpdfadfsqeiglasigasdediqllstcywftvefglck
    egdtiraygagilsstgemehfltdkakklpfnpfdacnteypittfqplyyvaesfqka
    keqmrqfadsfkkpfsirynpytqsieild
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jk8B (B:)
    mgsshhhhhhssglvprgshmasmesntnsqgqgiipqsyhssiffsiskgsdkigglle
    yleiikkhninitriesrpsktekkdydffldleyptennkevekvikdleekgvkattl
    qessnqtyapwfprkisdldlfankvlemgsdltsdhpgasdpvyrerrreiakiastyk
    hgdeipridyteeeiktwgvvynrlkelfptnachqhayifplleqncgyspdnipqlqd
    isnflqectgwrirpvqgllsardflnglafrvfhatqyirhpsvplytpepdcchellg
    hvplladpdfadfsqeiglasigasdediqllstcywftvefglckegdtiraygagils
    stgemehfltdkakklpfnpfdacnteypittfqplyyvaesfqkakeqmrqfadsfkkp
    fsirynpytqsieildnk
    

    Sequence, based on observed residues (ATOM records):
    >5jk8B (B:)
    syhssiffsiskgsdkigglleyleiikkhninitriesrpsktekkdydffldleypte
    nnkevekvikdleekgvkattlqessnqtyapwfprkisdldlfankgasdpvyrerrre
    iakiastykhgdeipridyteeeiktwgvvynrlkelfptnachqhayifplleqncgys
    pdnipqlqdisnflqectgwrirpvqgllsardflnglafrvfhatqyirhpsvplytpe
    pdcchellghvplladpdfadfsqeiglasigasdediqllstcywftvefglckegdti
    raygagilsstgemehfltdkakklpfnpfdacnteypittfqplyyvaesfqkakeqmr
    qfadsfkkpfsirynpytqsieild