PDB entry 5jjw

View 5jjw on RCSB PDB site
Description: crystal structure of the hat domain of sart3 in complex with usp15 dusp-ubl domain
Deposited on 2016-04-25, released 2016-05-04
The last revision was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Squamous cell carcinoma antigen recognized by T-cells 3
    Species: Homo sapiens [TaxId:9606]
    Gene: SART3, KIAA0156, TIP110
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Gene: USP15, KIAA0529
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, UNX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jjwA (A:)
    msviqnynkalqqlekykpyeeallqaeaprlaeyqayidfemkigdpariqliferalv
    enclvpdlwirysqyldrqlkvkdlvlsvhnrairncpwtvalwsryllamerhgvdhqv
    isvtfekalnagfiqatdyveiwqayldylrrrvdfkqdsskeleelraaftraleylkq
    eveerfnesgdpscvimqnwariearlcnnmqkarelwdsimtrgnakyanmwleyynle
    rahgdtqhcrkalhravqctsdypehvcevlltmertegsledwdiavqktetrlarvne
    

    Sequence, based on observed residues (ATOM records):
    >5jjwA (A:)
    sviqnynkalqqlekykpyeeallqaeaprlaeyqayidfemkigdpariqliferalve
    nclvpdlwirysqyldrqlkvkdlvlsvhnrairncpwtvalwsryllamerhgvdhqvi
    svtfekalnagfiqatdyveiwqayldylrrrvdfkqdsskeleelraaftraleylkqe
    veerfnesgdpscvimqnwariearlcnnmqkarelwdsimtrgnakyanmwleyynler
    ahgdtqhcrkalhravqctsdypehvcevlltmertegsledwdiavqktetrlar
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jjwB (B:)
    gmaeggaadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmgdqn
    vypgpidnsgllkdgdaqslkehlideldyillptegwnklvswytlmegqepiarkvve
    qgmfvkhckvevyltelklcengnmnnvvtrrfskadtidtiekeirkifsipdeketrl
    wnkymsntfeplnkpdstiqdaglyqgqvlvieqknedgtwprg
    

    Sequence, based on observed residues (ATOM records):
    >5jjwB (B:)
    aadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmgdqnvypgpi
    dnsgllkdgdslkehlideldyillptegwnklvswytlmegqepiarkvveqgmfvkhc
    kvevyltefskadtidtiekstiqdagly