PDB entry 5jjs

View 5jjs on RCSB PDB site
Description: dengue 3 ns5 protein with compound 27
Deposited on 2016-04-25, released 2016-07-06
The last revision was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Dengue virus 3 [TaxId:11069]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DLV0
      • engineered mutation (68)
      • engineered mutation (370)
  • Heterogens: ZN, PEG, 6L2, MG, EDO, SAH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jjsA (A:)
    smgetlgekwkkklnqlsrkefdlykksgitevdrteakeglkrgetthhavsrgsaklq
    wfvernmvipegrvidlgcgrggwsyycaglkkvtevrgytkggpgheepvpmstygwni
    vklmsgkdvfylppekcdtllcdigesspsptveesrtirvlkmvepwlknnqfcikvln
    pymptviehlerlqrkhggmlvrnplsrnsthemywisngtgnivssvnmvsrlllnrft
    mthrrptiekdvdlgagtrhvnaepetpnmdvigerikrikeehnstwhyddenpyktwa
    yhgsyevkatgsassmingvvklltkpwdvvpmvtqmamtdttpfgqqrvfkekvdtrtp
    rplpgtrkvmeitaewlwrtlgrnkrprlctreeftkkvrtnaamgavfteenqwdsaka
    avedeefwklvdrerelhklgkcgscvynmmgkrekklgefgkakgsraiwymwlgvryl
    efealgflnedhwfsrensysgvegeglhklgyilrdiskipggamyaddtagwdtrite
    ddlhneekiiqqmdpehrqlanaifkltyqnkvvkvqrptptgtvmdiisrkdqrgsgqv
    gtyglntftnmeaqlvrqmegegvltkadlenphllekkitqwletkgverlkrmaisgd
    dcvvkpiddrfanallalndmgkvrkdipqwqpskgwhdwqqvpfcshhfhelimkdgrk
    lvvpcrpqdeligrarisqgagwslretaclgkayaqmwslmyfhrrdlrlasnaicsav
    pvhwvptsrttwsihahhqwmttedmltvwnrvwieenpwmedktpvttwenvpylgkre
    dqwcgsligltsratwaqniptaiqqvrsligneefldympsmkrfrkeees
    

    Sequence, based on observed residues (ATOM records):
    >5jjsA (A:)
    getlgekwkkklnqlsrkefdlykksgitevdrteakeglkrgetthhavsrgsaklqwf
    vernmvipegrvidlgcgrggwsyycaglkkvtevrgytkggpgheepvpmstygwnivk
    lmsgkdvfylppekcdtllcdigesspsptveesrtirvlkmvepwlknnqfcikvlnpy
    mptviehlerlqrkhggmlvrnplsrnsthemywisngtgnivssvnmvsrlllnrftmt
    hrrptiekdvdlgagtrhvnaepetpnmdvigerikrikeehnstwhyddenpyktwayh
    gsyevkatgsassmingvvklltkpwdvvpmvtqmamtdttpfgqqrvfkekvdtrtprp
    lpgtrkvmeitaewlwrtlgrnkrprlctreeftkkvrtnwdsakaavedeefwklvdre
    relhklgkcgscvynmsraiwymwlgvrylefealgflnedhwfsrensysgvegeglhk
    lgyilrdiskipggamyaddtagwdtriteddlhneekiiqqmdpehrqlanaifkltyq
    nkvvkvqrptptgtvmdiisrkdqrgsgqvgtyglntftnmeaqlvrqmegegvltkadl
    enphllekkitqwletkgverlkrmaisgddcvvkpiddrfanallalndmgkvrkdipq
    wqpskgwhdwqqvpfcshhfhelimkdgrklvvpcrpqdeligrarisqgwslretaclg
    kayaqmwslmyfhrrdlrlasnaicsavpvhwvptsrttwsihahhqwmttedmltvwnr
    vwieenpwmedktpvttwenvpylgkredqwcgsligltsratwaqniptaiqqvrslig
    neefldymp