PDB entry 5jjp

View 5jjp on RCSB PDB site
Description: crystal structure of cmis6
Deposited on 2016-04-25, released 2017-03-22
The last revision was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nonribosomal peptide synthase
    Species: Streptomyces sp. MJ635-86F5 [TaxId:1321967]
    Gene: cmiS6
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nonribosomal peptide synthase
    Species: Streptomyces sp. MJ635-86F5 [TaxId:1321967]
    Gene: cmiS6
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nonribosomal peptide synthase
    Species: Streptomyces sp. MJ635-86F5 [TaxId:1321967]
    Gene: cmiS6
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nonribosomal peptide synthase
    Species: Streptomyces sp. MJ635-86F5 [TaxId:1321967]
    Gene: cmiS6
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jjpA (A:)
    mnhkvhhhhhhiegrhmspyaapvrdhagnlrdyllaagkatpdkpaivepaedgglrfv
    syrqleaqadayaaeldalgldvgdrvvlespatadavaaflacfslglpfiptipetpv
    qrlrtiigmaapalflqaadgsreglppglgmarfgpkgvtteqlpaprvrrrrqvvetd
    payliftsgttgrpkgvvmshraniafhrgirahgligpddrvavtspfsfdfclggial
    tlasgatavpvprdrldfprrflaflheaaitqvhgvpslwrplirhepdlvagldplrs
    ilfsgedfplgdlrelqgllpgrrifnlygatesmaasvtdvpdplpadlerltigyahh
    gaemdvydaegapvgepgvvgeiylrspalfsgywadpeatraalvpdpllpesgqvvfr
    tgdlayrdadgrlyfcgridsqvqirgnrvelgeverrlrefpgvsgavalvapagegep
    elsafltmrpgapapklvplrafcaetlpeymaprsltvlaelpvttngkidkdallrar
    tar
    

    Sequence, based on observed residues (ATOM records):
    >5jjpA (A:)
    spyaapvrdhagnlrdyllaagkatpdkpaivepagglrfvsyrqleaqadayaaeldal
    gldvgdrvvlespatadavaaflacfslglpfiptipetpvqrlrtiigmaapalflqaa
    dgsreglppglgmarfgpkgvtteqlpaprvrrrrqvvetdpayliftpkgvvmshrani
    afhrgirahgligpddrvavtspfsfdfclggialtlasgatavpvprdrldfprrflaf
    lheaaitqvhgvpslwrplirhepdlvagldplrsilfsgedfplgdlrelqgllpgrri
    fnlygatesmaasvtdvpdplpadlerltigyahhgaemdvydaegapvgepgvvgeiyl
    rspalfsgywadpeatraalvpdpllpesgqvvfrtgdlayrdadgrlyfcgri
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jjpB (B:)
    mnhkvhhhhhhiegrhmspyaapvrdhagnlrdyllaagkatpdkpaivepaedgglrfv
    syrqleaqadayaaeldalgldvgdrvvlespatadavaaflacfslglpfiptipetpv
    qrlrtiigmaapalflqaadgsreglppglgmarfgpkgvtteqlpaprvrrrrqvvetd
    payliftsgttgrpkgvvmshraniafhrgirahgligpddrvavtspfsfdfclggial
    tlasgatavpvprdrldfprrflaflheaaitqvhgvpslwrplirhepdlvagldplrs
    ilfsgedfplgdlrelqgllpgrrifnlygatesmaasvtdvpdplpadlerltigyahh
    gaemdvydaegapvgepgvvgeiylrspalfsgywadpeatraalvpdpllpesgqvvfr
    tgdlayrdadgrlyfcgridsqvqirgnrvelgeverrlrefpgvsgavalvapagegep
    elsafltmrpgapapklvplrafcaetlpeymaprsltvlaelpvttngkidkdallrar
    tar
    

    Sequence, based on observed residues (ATOM records):
    >5jjpB (B:)
    pyaapvrdhagnlrdyllaagkatpdkpaivepaedgglrfvsyrqleaqadayaaelda
    lgldvgdrvvlespatadavaaflacfslglpfiptipetpvqrlrtiigmaapalflqa
    adgsreglppglgmarfgpkgvtteqlpaprvrrrrqvvetdpayliftgrpkgvvmshr
    aniafhrgirahgligpddrvavtspfsfdfclggialtlasgatavpvprdrldfprrf
    laflheaaitqvhgvpslwrplirhepdlvagldplrsilfsgedfplgdlrelqgllpg
    rrifnlygatesmaasvtdvpdplpadlerltigyahhgaemdvydaegapvgepgvvge
    iylrspalfsgywadpeatraalvpdpllpesgqvvfrtgdlayrdadgrlyfcgrid
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jjpC (C:)
    mnhkvhhhhhhiegrhmspyaapvrdhagnlrdyllaagkatpdkpaivepaedgglrfv
    syrqleaqadayaaeldalgldvgdrvvlespatadavaaflacfslglpfiptipetpv
    qrlrtiigmaapalflqaadgsreglppglgmarfgpkgvtteqlpaprvrrrrqvvetd
    payliftsgttgrpkgvvmshraniafhrgirahgligpddrvavtspfsfdfclggial
    tlasgatavpvprdrldfprrflaflheaaitqvhgvpslwrplirhepdlvagldplrs
    ilfsgedfplgdlrelqgllpgrrifnlygatesmaasvtdvpdplpadlerltigyahh
    gaemdvydaegapvgepgvvgeiylrspalfsgywadpeatraalvpdpllpesgqvvfr
    tgdlayrdadgrlyfcgridsqvqirgnrvelgeverrlrefpgvsgavalvapagegep
    elsafltmrpgapapklvplrafcaetlpeymaprsltvlaelpvttngkidkdallrar
    tar
    

    Sequence, based on observed residues (ATOM records):
    >5jjpC (C:)
    spyaapvrdhagnlrdyllaagkatpdkpaivepaedgglrfvsyrqleaqadayaaeld
    algldvgdrvvlespatadavaaflacfslglpfiptipetpvqrlrtiigmaapalflq
    aadgsreglppglgmarfgpkgvtteqlpaprvrrrrqvvetdpayliftkgvvmshran
    iafhrgirahgligpddrvavtspfsfdfclggialtlasgatavpvprdrlrrflaflh
    eaaitqvhgvpslwrpepdlvagldplrsilfsgdlrelqgllpgrrifnlygatesmaa
    svtdvprltigyahhgaemdvydaegapvpgvvgeiylrspalfsgywadpeatraalvp
    dpllpesgqvvfrtgdlayrdadgrlyfcgri
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jjpD (D:)
    mnhkvhhhhhhiegrhmspyaapvrdhagnlrdyllaagkatpdkpaivepaedgglrfv
    syrqleaqadayaaeldalgldvgdrvvlespatadavaaflacfslglpfiptipetpv
    qrlrtiigmaapalflqaadgsreglppglgmarfgpkgvtteqlpaprvrrrrqvvetd
    payliftsgttgrpkgvvmshraniafhrgirahgligpddrvavtspfsfdfclggial
    tlasgatavpvprdrldfprrflaflheaaitqvhgvpslwrplirhepdlvagldplrs
    ilfsgedfplgdlrelqgllpgrrifnlygatesmaasvtdvpdplpadlerltigyahh
    gaemdvydaegapvgepgvvgeiylrspalfsgywadpeatraalvpdpllpesgqvvfr
    tgdlayrdadgrlyfcgridsqvqirgnrvelgeverrlrefpgvsgavalvapagegep
    elsafltmrpgapapklvplrafcaetlpeymaprsltvlaelpvttngkidkdallrar
    tar
    

    Sequence, based on observed residues (ATOM records):
    >5jjpD (D:)
    spyaapvrdhagnlrdyllaagkatpdkpaivepaedgglrfvsyrqleaqadayaaeld
    algldvgdrvvlespatadavaaflacfslglpfiptipetpvqrlrtiigmaapalflq
    aadgsreglppglgmarfgpkgvtteqlpaprvrrrrqvvetdpayliftpkgvvmshra
    niafhrgirahgligpddrvavtspfsfdfclggialtlasgatavpvprdrldfprrfl
    aflheaaitqvhgvpslwrplirhepdlvagldplrsilfsgedfplgdlrelqgllpgr
    rifnlygatesmaasvtdvpdplpadlerltigyahhgaemdvydaegapvgepgvvgei
    ylrspalfsgywadpeatraalvpdpllpesgqvvfrtgdlayrdadgrlyfcgri