PDB entry 5jjm

View 5jjm on RCSB PDB site
Description: Crystal Structure of Homodimeric Androgen Receptor Ligand-Binding Domain bound to DHT and LxxLL peptide
Class: transcription
Keywords: nuclear receptor, transcription factor, oxosteroid receptor, human androgen receptor, Transcription
Deposited on 2016-04-24, released 2017-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AR, DHTR, NR3C4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jjma_
  • Chain 'B':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AR, DHTR, NR3C4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jjmb_
  • Chain 'C':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AR, DHTR, NR3C4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jjmc_
  • Chain 'D':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AR, DHTR, NR3C4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jjmd_
  • Chain 'F':
    Compound: Unknown peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JJM (0-2)
  • Chain 'G':
    Compound: uba3-derived peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JJM (0-End)
  • Chain 'H':
    Compound: uba3-derived peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JJM (0-7)
  • Chain 'I':
    Compound: uba3-derived peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JJM (0-7)
  • Chain 'J':
    Compound: uba3-derived peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JJM (0-7)
  • Chain 'K':
    Compound: Unknown peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JJM (0-2)
  • Chain 'L':
    Compound: Unknown peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JJM (0-2)
  • Chain 'M':
    Compound: Unknown peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JJM (0-2)
  • Heterogens: DHT, ZN, CL, EDO, GOL, SO4, PGE, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jjmA (A:)
    ecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrn
    lhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrm
    rhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrk
    nptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkil
    sgkvkpiyfhtq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jjmB (B:)
    ecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrn
    lhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrm
    rhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrk
    nptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkil
    sgkvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jjmB (B:)
    cqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnl
    hvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmr
    hlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrkn
    ptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkils
    gkvkpiyfhtq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jjmC (C:)
    ecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrn
    lhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrm
    rhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrk
    nptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkil
    sgkvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jjmC (C:)
    ecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrn
    lhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrm
    rhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrk
    nptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkil
    sgkvkpiyfh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5jjmD (D:)
    ecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrn
    lhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrm
    rhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrk
    nptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkil
    sgkvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jjmD (D:)
    cqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnl
    hvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmr
    hlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrkn
    ptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkils
    gkvkpiyfh
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.