PDB entry 5jjl

View 5jjl on RCSB PDB site
Description: rho transcription termination factor bound to ru8 and 5 adp-bef3 molecules
Deposited on 2016-04-24, released 2016-11-16
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription termination factor rho
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: rho, Z5293, ECs4716
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AG32 (4-End)
      • expression tag (3)
  • Chain 'B':
    Compound: transcription termination factor rho
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: rho, Z5293, ECs4716
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AG32 (4-419)
      • expression tag (3)
  • Chain 'C':
    Compound: transcription termination factor rho
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: rho, Z5293, ECs4716
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AG32 (4-419)
      • expression tag (3)
  • Chain 'D':
    Compound: transcription termination factor rho
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: rho, Z5293, ECs4716
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AG32 (4-End)
      • expression tag (3)
  • Chain 'E':
    Compound: transcription termination factor rho
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: rho, Z5293, ECs4716
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: transcription termination factor rho
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: rho, Z5293, ECs4716
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AG32 (4-End)
      • expression tag (3)
  • Chain 'G':
    Compound: rU12: RNA (5'-R(P*UP*UP*UP*UP*UP*UP*U)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: ADP, MG, BEF, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jjlA (A:)
    mghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvlei
    lqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvn
    evnfdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrgliv
    appkagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepas
    rhvqvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrp
    krffgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpa
    idynrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

    Sequence, based on observed residues (ATOM records):
    >5jjlA (A:)
    mnltelkntpvselitlgrkqdiifailkqhaksgedifgdgvleilqdgfgflrsadss
    ylagpddiyvspsqirrfnlrtgdtisgkirppkefallkvnevnfdkpkilfenltplh
    ansrlrmergngstedltarvldlaspigrgqrglivappkagktmllqniaqsiaynhp
    dcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviekakrlvehkkdv
    iilldsitrlarayntvvpasgkvltggvdanalhrpkrffgaarnveeggsltiiatal
    idtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeellttqeelqkm
    wilrkiihpmgeidameflinklamtktnddffemm
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jjlB (B:)
    mghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvlei
    lqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvn
    evnfdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrgliv
    appkagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepas
    rhvqvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrp
    krffgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpa
    idynrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

    Sequence, based on observed residues (ATOM records):
    >5jjlB (B:)
    mnltelkntpvselitlgenmrkqdiifailkqhaksgedifgdgvleilqdgfgflrsa
    dssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevnfdkpenar
    nkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivappkagktmll
    qniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemvie
    kakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrffgaarnve
    eggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrke
    ellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jjlC (C:)
    mghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvlei
    lqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvn
    evnfdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrgliv
    appkagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepas
    rhvqvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrp
    krffgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpa
    idynrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

    Sequence, based on observed residues (ATOM records):
    >5jjlC (C:)
    mnltelkntpvselitlgenmglenlmrkqdiifailkqhaksgedifgdgvleilqdgf
    gflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevnfd
    kpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivappka
    gktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqv
    aemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrffg
    aarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynr
    sgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jjlD (D:)
    mghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvlei
    lqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvn
    evnfdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrgliv
    appkagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepas
    rhvqvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrp
    krffgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpa
    idynrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

    Sequence, based on observed residues (ATOM records):
    >5jjlD (D:)
    mnltelkntpvselitlgenmgrkqdiifailkqhaksgedifgdgvleilqdgfgflrs
    adssylagpddiyvspsqirrfnlrtgdtisgkirpperyfallkvnevnfdkpenarnk
    ilfenltplhansrlrmergngstedltarvldlaspigrgqrglivappkagktmllqn
    iaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemvieka
    krlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrffgaarnveeg
    gsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeel
    lttqeelqkmwilrkiihpmgeidameflinklamtktnddffemm
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5jjlE (E:)
    mghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvlei
    lqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvn
    evnfdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrgliv
    appkagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepas
    rhvqvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrp
    krffgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpa
    idynrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

    Sequence, based on observed residues (ATOM records):
    >5jjlE (E:)
    nltelkntpvselitlgenmgrkqdiifailkqhakifgdgvleilqdgfgflrsadssy
    lagpddiyvspsqirrfnlrtgdtisgkifallkvnevnfdkpenarnkilfenltplha
    nsrlrmngstedltarvldlaspigrgqrglivappkagktmllqniaqsiaynhpdcvl
    mvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviekakrlvehkkdviill
    dsitrlarayntvvpasgkvltggvdanalhrpkrffgaarnveeggsltiiatalidtg
    skmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeellttqeelqkmwilr
    kiihpmgeidameflinklam
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5jjlF (F:)
    mghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvlei
    lqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvn
    evnfdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrgliv
    appkagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepas
    rhvqvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrp
    krffgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpa
    idynrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

    Sequence, based on observed residues (ATOM records):
    >5jjlF (F:)
    mnltelkntpvselitlgenmmrkqdiifailkqhaksgeifgdgvleilqdgfgflrsa
    dssylagpddiyvspsqirrfnlrtgdtisgkirppkfallkvnevnfdkpenarnkilf
    enltplhansrlrmergngstedltarvldlaspigrgqrglivappkagktmllqniaq
    siaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviekakrl
    vehkkdviilldsitrlarayntvvpasgkvltgvdanalhrpkrffgaarnveeggslt
    iiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeellttq
    eelqkmwilrkiihpmgeidameflinklamtktnddffemm
    

  • Chain 'G':
    No sequence available.