PDB entry 5jj4

View 5jj4 on RCSB PDB site
Description: crystal structure of a variant human activation-induced deoxycytidine deaminase as an mbp fusion protein
Deposited on 2016-04-22, released 2016-06-29
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltose-binding periplasmic protein,Single-stranded DNA cytosine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: AICDA, AID
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEY0 (0-366)
      • conflict (358)
      • conflict (361-362)
      • conflict (366)
      • linker (367-384)
    • Uniprot Q9GZX7 (385-End)
      • conflict (387-388)
      • conflict (394)
      • conflict (396)
      • conflict (398)
  • Chain 'B':
    Compound: Maltose-binding periplasmic protein,Single-stranded DNA cytosine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: AICDA, AID
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEY0 (0-366)
      • conflict (358)
      • conflict (361-362)
      • conflict (366)
      • linker (367-384)
    • Uniprot Q9GZX7 (385-End)
      • conflict (387-388)
      • conflict (394)
      • conflict (396)
      • conflict (398)
  • Chain 'C':
    Compound: Maltose-binding periplasmic protein,Single-stranded DNA cytosine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: AICDA, AID
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEY0 (0-366)
      • conflict (358)
      • conflict (361-362)
      • conflict (366)
      • linker (367-384)
    • Uniprot Q9GZX7 (385-End)
      • conflict (387-388)
      • conflict (394)
      • conflict (396)
      • conflict (398)
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jj4A (A:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
    laaaqtnaaalmdphiftsnfnngigrhktylcyeverldsatsfsldfgylrnkngchv
    ellflryisdwdldpgrcyrvtwftswspcydcarhvadflrgnpnlslriftarlyfce
    drkaepeglrrlhragvqiaimtfkdyfycwntfvenhertfkaweglhensvrlsrqlr
    rillpl
    

    Sequence, based on observed residues (ATOM records):
    >5jj4A (A:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
    laaaqtnaaalmdphiftsnfnngigrhktylcyeverldtsfsldfgylrnkngchvel
    lflryisdwdldpgrcyrvtwftswspcydcarhvadflrgnpnlslriftarlyfcedr
    kaepeglrrlhragvqiaimtfkdyfycwntfvenhertfkaweglhensvrlsrqlrri
    ll
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jj4B (B:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
    laaaqtnaaalmdphiftsnfnngigrhktylcyeverldsatsfsldfgylrnkngchv
    ellflryisdwdldpgrcyrvtwftswspcydcarhvadflrgnpnlslriftarlyfce
    drkaepeglrrlhragvqiaimtfkdyfycwntfvenhertfkaweglhensvrlsrqlr
    rillpl
    

    Sequence, based on observed residues (ATOM records):
    >5jj4B (B:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
    laaaqtnaaalmdphiftsnfnngigrhktylcyeverldsatsfsldfgylrnkngchv
    ellflryisdwdldpgrcyrvtwftswspcydcarhvadflrgnpnlslriftarlyfce
    drkaepeglrrlhragvqiaimtfkdyfycwntfvenhertfkaweglhensvrlsrqlr
    rillp
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jj4C (C:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
    laaaqtnaaalmdphiftsnfnngigrhktylcyeverldsatsfsldfgylrnkngchv
    ellflryisdwdldpgrcyrvtwftswspcydcarhvadflrgnpnlslriftarlyfce
    drkaepeglrrlhragvqiaimtfkdyfycwntfvenhertfkaweglhensvrlsrqlr
    rillpl
    

    Sequence, based on observed residues (ATOM records):
    >5jj4C (C:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
    laaaqtnaaalmdphiftsnfnngigrhktylcyeverldsfsldfgylrnkngchvell
    flryisdwdldpgrcyrvtwftswspcydcarhvadflrgnpnlslriftarlyfcedrk
    aepeglrrlhragvqiaimtfkdyfycwntfvenhertfkaweglhensvrlsrqlrril
    l