PDB entry 5jj1

View 5jj1 on RCSB PDB site
Description: structure of the immature procapsid conformation of p22 portal protein
Deposited on 2016-04-22, released 2017-02-08
The last revision was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: portal protein
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: portal protein
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: portal protein
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: portal protein
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: portal protein
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: portal protein
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: portal protein
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: portal protein
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: portal protein
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: portal protein
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: portal protein
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: portal protein
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jj1A (A:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jj1A (A:)
    esilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvvrklv
    semrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvgawrl
    vtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngwedfa
    ekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepvsyfk
    rdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvfgewg
    fvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmydgndd
    ypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdteavngg
    qvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvtitledgsek
    dvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellgktpqgtpe
    yqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jj1B (B:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jj1B (B:)
    esilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvvrklv
    semrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvgawrl
    vtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngwedfa
    ekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepvsyfk
    rdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvfgewg
    fvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmydgndd
    ypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdteavngg
    qvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvtitledgsek
    dvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellgktpqgtpe
    yqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jj1C (C:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jj1C (C:)
    esilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvvrklv
    semrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvgawrl
    vtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngwedfa
    ekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepvsyfk
    rdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvfgewg
    fvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmydgndd
    ypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdteavngg
    qvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvtitledgsek
    dvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellgktpqgtpe
    yqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jj1D (D:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jj1D (D:)
    esilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvvrklv
    semrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvgawrl
    vtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngwedfa
    ekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepvsyfk
    rdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvfgewg
    fvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmydgndd
    ypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdteavngg
    qvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvtitledgsek
    dvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellgktpqgtpe
    yqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwl
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5jj1E (E:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jj1E (E:)
    esilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvvrklv
    semrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvgawrl
    vtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngwedfa
    ekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepvsyfk
    rdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvfgewg
    fvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmydgndd
    ypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdteavngg
    qvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvtitledgsek
    dvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellgktpqgtpe
    yqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwl
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5jj1F (F:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jj1F (F:)
    esilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvvrklv
    semrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvgawrl
    vtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngwedfa
    ekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepvsyfk
    rdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvfgewg
    fvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmydgndd
    ypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdteavngg
    qvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvtitledgsek
    dvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellgktpqgtpe
    yqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwl
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5jj1G (G:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jj1G (G:)
    esilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvvrklv
    semrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvgawrl
    vtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngwedfa
    ekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepvsyfk
    rdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvfgewg
    fvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmydgndd
    ypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdteavngg
    qvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvtitledgsek
    dvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellgktpqgtpe
    yqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwl
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5jj1H (H:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jj1H (H:)
    esilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvvrklv
    semrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvgawrl
    vtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngwedfa
    ekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepvsyfk
    rdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvfgewg
    fvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmydgndd
    ypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdteavngg
    qvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvtitledgsek
    dvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellgktpqgtpe
    yqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwl
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5jj1I (I:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jj1I (I:)
    esilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvvrklv
    semrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvgawrl
    vtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngwedfa
    ekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepvsyfk
    rdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvfgewg
    fvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmydgndd
    ypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdteavngg
    qvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvtitledgsek
    dvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellgktpqgtpe
    yqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwl
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >5jj1J (J:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jj1J (J:)
    esilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvvrklv
    semrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvgawrl
    vtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngwedfa
    ekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepvsyfk
    rdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvfgewg
    fvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmydgndd
    ypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdteavngg
    qvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvtitledgsek
    dvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellgktpqgtpe
    yqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwl
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >5jj1K (K:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jj1K (K:)
    esilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvvrklv
    semrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvgawrl
    vtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngwedfa
    ekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepvsyfk
    rdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvfgewg
    fvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmydgndd
    ypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdteavngg
    qvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvtitledgsek
    dvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellgktpqgtpe
    yqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwl
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5jj1L (L:)
    madnenrlesilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvv
    rpvvrklvsemrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqie
    agvgawrlvtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsms
    qngwedfaekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvt
    gepvsyfkrdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipi
    vpvfgewgfvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfe
    hmydgnddypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgv
    dteavnggqvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvti
    tledgsekdvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellg
    ktpqgtpeyqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwlveaqqak
    qglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jj1L (L:)
    esilsrfdadwtasdearreakndlffsrvsqwddwlsqyttlqyrgqfdvvrpvvrklv
    semrqnpidvlyrpkdgarpdaadvlmgmyrtdmrhntakiavniavreqieagvgawrl
    vtdyedqsptsnnqvirrepihsacshviwdsnsklmdksdarhctvihsmsqngwedfa
    ekydldaddipsfqnpndwvfpwltqdtiqiaefyevvekketafiyqdpvtgepvsyfk
    rdikdviddladsgfikiaerqikrrrvyksiitctavlkdkqliagehipivpvfgewg
    fvedkevyegvvrltkdgqrlrnmimsfnadivartpkkkpffwpeqiagfehmydgndd
    ypyyllnrtdensgdlptqplayyenpevpqanaymleaatsavkevatlgvdteavngg
    qvafdtvnqlnmradletyvfqdnlatamrrdgeiyqsivndiydvprnvtitledgsek
    dvqlmaevvdlatgekqvlndirgryecytdvgpsfqsmkqqnraeilellgktpqgtpe
    yqllllqyftlldgkgvemmrdyankqliqmgvkkpetpeeqqwl