PDB entry 5jiz

View 5jiz on RCSB PDB site
Description: pkg ii's carboxyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp
Deposited on 2016-04-22, released 2017-05-03
The last revision was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-dependent protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG2, PRKGR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13237 (2-151)
      • expression tag (1)
  • Heterogens: 6FW, MPD, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jizA (A:)
    gstaqardeqyrnflrsvsllknlpedkltkiidcleveyydkgdyiiregeegstffil
    akgkvkvtqsteghdqpqliktlqkgeyfgekalisddvrsaniiaeendvaclvidret
    fnqtvgtfeelqkylegyvanlnrddekrhak
    

    Sequence, based on observed residues (ATOM records):
    >5jizA (A:)
    staqardeqyrnflrsvsllknlpedkltkiidcleveyydkgdyiiregeegstffila
    kgkvkvtqsteghdqpqliktlqkgeyfgekalisddvrsaniiaeendvaclvidretf
    nqtvgtfeelqkylegyvanlnrddekrhak