PDB entry 5jiw

View 5jiw on RCSB PDB site
Description: Crystal structure of Thermus aquaticus amylomaltase (GH77) in complex with a 34-meric cycloamylose
Class: hydrolase
Keywords: glycoside hydrolase, TIM barrel cycloamylose, Hydrolase
Deposited on 2016-04-22, released 2017-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-alpha-glucanotransferase
    Species: Thermus aquaticus [TaxId:271]
    Gene: malq
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87172 (0-499)
      • engineered mutation (292)
      • conflict (369)
      • engineered mutation (394)
    Domains in SCOPe 2.06: d5jiwa_
  • Heterogens: BGC, GLC, EDO, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jiwA (A:)
    melprafglllhptslpgpygvgvlgreardflrflkeaggrywqvlplgptgygdspyq
    sfsafagnpylidlrplaergyvrledpgfpqgrvdygllyawkwpalkeafrgfkekas
    peereafaafrereawwledyalfmalkgahgglpwnrwplplrkreekalreaksalae
    evafhaftqwlffrqwgalkaeaealgiriigdmpifvaedsaevwahpewfhldeegrp
    tvvagvppdyfsetgqrwgnplyrwdvleregfsfwirrlekalelfhlvriahfrgfea
    yweipascptavegrwvkapgeklfqkiqevfgevpvlaedlgvitpevealrdrfglpg
    mkvlqfafdxgmenpflphnypahgrvvvytgthnndttlgwyrtatphekafmarylad
    wgitfreeeevpwalmhlgmksvarlavypvqdvlalgsearmnypgrpsgnwawrllpg
    elspehgarlramaeaterl