PDB entry 5jir

View 5jir on RCSB PDB site
Description: crystal structure of treponema pallidum protein tp0624
Deposited on 2016-04-22, released 2016-11-23
The last revision was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: OOP family OmpA-OmpF porin
    Species: Treponema pallidum (strain Nichols) [TaxId:243276]
    Gene: TP_0624, TPANIC_0624
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: OOP family OmpA-OmpF porin
    Species: Treponema pallidum (strain Nichols) [TaxId:243276]
    Gene: TP_0624, TPANIC_0624
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jirA (A:)
    gsmastqdavhtdavqdwkngtinaqltldlararmrlpadrtaasqflrykapaqlkdv
    ylsvlvdsqnrvgdclahekirladitalvdaghhavttlspsvrslqlshqtpltalar
    lfvthetayvpaipptsavsrpytgilidargslpvhgeyvseplsaclfpkiwstdmdl
    iyeknmvhpdrakawgvvrygsvwdekmyrdrigttplkiiargvfgqqrtdpiiaskda
    aqilarpenlrllaegnviilcdeaalrvhvpyplvdehfyfayhdvkrfltderspgvg
    vrsgintlkitvydvrfvanspeilasekdrvdviatalkkmgpytrflieghtadlhrp
    qeeaalsvaraqrmaqelsrrgiemtrittaghgatkpiapsdthankaknrrveitilr
    d
    

    Sequence, based on observed residues (ATOM records):
    >5jirA (A:)
    avhtdavqdwkngtinaqltldlararmrlpadrtaasqflrykapaqlkdvylsvlvds
    qnrvgdclahekirladitalvdaghhavttlspsvrslqlshqtpltalarlfvtheta
    yvpaipptsavsrpytgilidargslpvhgeyvseplsaclfpkiwstdmdliyeknmvh
    pdrakawgvvrygsvwdekmyrdrigttplkiiargvfgqqrtdpiiaskdaaqilarpe
    nlrllaegnviilcdeaalrvhvpyplvdehfyfayhdvkrfltderspgvgvrsgintl
    kitvydvrfvanspeilasekdrvdviatalkkmgpytrflieghtadlhrpqeeaalsv
    araqrmaqelsrrgiemtrittaghgatkpiapsdthankaknrrveitilrd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jirB (B:)
    gsmastqdavhtdavqdwkngtinaqltldlararmrlpadrtaasqflrykapaqlkdv
    ylsvlvdsqnrvgdclahekirladitalvdaghhavttlspsvrslqlshqtpltalar
    lfvthetayvpaipptsavsrpytgilidargslpvhgeyvseplsaclfpkiwstdmdl
    iyeknmvhpdrakawgvvrygsvwdekmyrdrigttplkiiargvfgqqrtdpiiaskda
    aqilarpenlrllaegnviilcdeaalrvhvpyplvdehfyfayhdvkrfltderspgvg
    vrsgintlkitvydvrfvanspeilasekdrvdviatalkkmgpytrflieghtadlhrp
    qeeaalsvaraqrmaqelsrrgiemtrittaghgatkpiapsdthankaknrrveitilr
    d
    

    Sequence, based on observed residues (ATOM records):
    >5jirB (B:)
    davhtdavqdwkngtinaqltldlararmrlpadrtaasqflrykapaqlkdvylsvlvd
    sqnrvgdclahekirladitalvdaghhavttlspsvrslqlshqtpltalarlfvthet
    ayvsrpytgilidargslpvhgeyvseplsaclfpkiwstdmdliyeknmvhpdrakawg
    vvrygsvwdekmyrdrigttplkiiargvfgqqrtdpiiaskdaaqilarpenlrllaeg
    nviilcdeaalrvhvpyplvdehfyfayhdvkrfltderspgvgvrsgintlkitvydvr
    fvanspeilasekdrvdviatalkkmgpytrflieghtadlhrpqeeaalsvaraqrmaq
    elsrrgiemtrittaghgatkpiapsdthankaknrrveitilrd