PDB entry 5jip

View 5jip on RCSB PDB site
Description: crystal structure of the clostridium perfringens spore cortex lytic enzyme slem
Deposited on 2016-04-22, released 2016-08-10
The last revision was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cortical-lytic enzyme
    Species: Clostridium perfringens [TaxId:1502]
    Gene: sleM
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06496 (6-End)
      • expression tag (3-5)
  • Chain 'B':
    Compound: Cortical-lytic enzyme
    Species: Clostridium perfringens [TaxId:1502]
    Gene: sleM
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MES, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jipA (A:)
    mgggfaqdknplstfgpdlnefsrdvnfltlaknsdfiylrasgsgtgklridnkflefa
    kecrrlgipcgayhfakpskdldsaviqadqfidvlqqgfgdgdygdlfpvldvetptdk
    sltttelvnwidrfrdrfeektrrrlmlytglffiglyddfkvpgkgyplsdmplwiamy
    tripsnprippnvggwkrwtmwqftdegkldgvgspvdlnwgpnsidslmppsavtglna
    yisgnkifvnwtankeddlngynvfvndnyagtlprkatkividksrfylpkgkpikisi
    eafditgdfskerteyildnngeflgenlyfq
    

    Sequence, based on observed residues (ATOM records):
    >5jipA (A:)
    gfaqdknplstfgpdlnefsrdvnfltlaknsdfiylrasgsgtgklridnkflefakec
    rrlgipcgayhfakpskdldsaviqadqfidvlqqgfgdgdygdlfpvldvetptdkslt
    ttelvnwidrfrdrfeektrrrlmlytglffiglyddfkvpgkgyplsdmplwiamytri
    psnprippnvggwkrwtmwqftdegkldgvgspvdlnwgpnsidslmppsavtglnayis
    gnkifvnwtankeddlngynvfvndnyagtlprkatkividksrfylpkgkpikisieaf
    ditgdfskerteyildn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jipB (B:)
    mgggfaqdknplstfgpdlnefsrdvnfltlaknsdfiylrasgsgtgklridnkflefa
    kecrrlgipcgayhfakpskdldsaviqadqfidvlqqgfgdgdygdlfpvldvetptdk
    sltttelvnwidrfrdrfeektrrrlmlytglffiglyddfkvpgkgyplsdmplwiamy
    tripsnprippnvggwkrwtmwqftdegkldgvgspvdlnwgpnsidslmppsavtglna
    yisgnkifvnwtankeddlngynvfvndnyagtlprkatkividksrfylpkgkpikisi
    eafditgdfskerteyildnngeflgenlyfq
    

    Sequence, based on observed residues (ATOM records):
    >5jipB (B:)
    qdknplstfgpdlnefsrdvnfltlaknsdfiylrasgsgtgklridnkflefakecrrl
    gipcgayhfakpskdldsaviqadqfidvlqqgfgdgdygdlfpvldvetptdkslttte
    lvnwidrfrdrfeektrrrlmlytglffiglyddfkvpgkgyplsdmplwiamytripsn
    prippnvggwkrwtmwqftdegkldgvgspvdlnwgpnsidslmppsavtglnayisgnk
    ifvnwtankeddlngynvfvndnyagtlprkatkividksrfylpkgkpikisieafdit
    gdfskerteyildn