PDB entry 5jin

View 5jin on RCSB PDB site
Description: structure of g9a set-domain with histone h3k9m mutant peptide and bound s-adenosylmethionine
Deposited on 2016-04-22, released 2016-07-06
The last revision was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase EHMT2
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT2, BAT8, C6orf30, G9A, KMT1C, NG36
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Histone-lysine N-methyltransferase EHMT2
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT2, BAT8, C6orf30, G9A, KMT1C, NG36
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Histone H3.1 peptide with K9M mutation
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JIN
  • Chain 'G':
    Compound: Histone H3.1 peptide with K9M mutation
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JIN (0-End)
  • Heterogens: ZN, SAM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jinA (A:)
    irtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhct
    cvddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsg
    ikvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkdge
    vycidaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdyg
    drfwdikskyftcqcgsekckhsaeaialeqsrl
    

    Sequence, based on observed residues (ATOM records):
    >5jinA (A:)
    irtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhct
    cvddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsg
    ikvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkdge
    vycidaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdyg
    drfwdikskyftcqcgsekckhsaeaialeqsr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jinB (B:)
    irtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhct
    cvddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsg
    ikvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkdge
    vycidaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdyg
    drfwdikskyftcqcgsekckhsaeaialeqsrl
    

    Sequence, based on observed residues (ATOM records):
    >5jinB (B:)
    ekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcvd
    dcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgikv
    rlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldevycidar
    yygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwdik
    skyftcqcgsekckhsaeaialeqsrl
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5jinF (F:)
    tkqtarmstgg
    

    Sequence, based on observed residues (ATOM records):
    >5jinF (F:)
    kqtarmst
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5jinG (G:)
    tkqtarmstgg
    

    Sequence, based on observed residues (ATOM records):
    >5jinG (G:)
    tkqtarmst