PDB entry 5jig

View 5jig on RCSB PDB site
Description: crytsal structure of wss1 from s. pombe
Deposited on 2016-04-22, released 2016-11-09
The last revision was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin and WLM domain-containing metalloprotease SPCC1442.07c
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: SPCC1442.07c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94580 (0-126)
      • conflict (0)
  • Heterogens: NI, OXY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jigA (A:)
    gsiytfnelvvldyphkdralrylerlrddtgikkimdshrwtvpllsemdpaehtrhds
    ktlglnhnqgahielrlrtdrydgfrdyktvkstlihelthnvhgehdssfwelfrqltk
    eadaadl
    

    Sequence, based on observed residues (ATOM records):
    >5jigA (A:)
    gsiytfnelvvldyphkdralrylerlrddtgikkimdshrwtvpllsemdptlglnhnq
    gahielrlrtdrydgfrdyktvkstlihelthnvhgehdssfwelfrqltkeadaadl