PDB entry 5jic

View 5jic on RCSB PDB site
Description: Staphylococcus aureus Type II pantothenate kinase in complex with a pantothenate analog
Class: Transferase/Transferase Inhibitor
Keywords: pantothenamide, inhibitor, antimicrobial, Transferase-Transferase Inhibitor complex
Deposited on 2016-04-22, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus (strain MW2) [TaxId:196620]
    Gene: coaW, MW2054
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NVG0 (Start-266)
      • expression tag (267-272)
    Domains in SCOPe 2.07: d5jica1, d5jica2
  • Heterogens: MG, ADP, N7E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jicA (A:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalylekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jicA (A:)
    kvgidaggtlikivqeqrtfkteltknidqvvewlnqqqieklcltggnagviaeninip
    aqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtgggmi
    qglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvlhhld
    adftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedytvlr
    gckpyyvengafsgaigalylekhhhhhh