PDB entry 5jib

View 5jib on RCSB PDB site
Description: Crystal structure of the Thermotoga maritima acetyl esterase (TM0077) complex with a substrate analog
Class: hydrolase
Keywords: hydrolase, carbohydrate metabolism, cephalosporin deacetylase, rossmann fold
Deposited on 2016-04-22, released 2017-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jiba_
  • Chain 'B':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jibb_
  • Chain 'C':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jibc_
  • Chain 'D':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jibd_
  • Chain 'E':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jibe_
  • Chain 'F':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jibf_
  • Heterogens: OIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jibA (A:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jibA (A:)
    fdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfsg
    yrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqgsg
    wlkgdtpdypgpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqerivi
    aggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdkee
    ivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynnhe
    gggsfqaveqvkflkklfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jibB (B:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jibB (B:)
    fdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfsg
    yrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqgsg
    wlkgdtpdypgpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqerivi
    aggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdkee
    ivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynnhe
    gggsfqaveqvkflkklfe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jibC (C:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jibC (C:)
    fdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfsg
    yrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqgsg
    wlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqeriv
    iaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdke
    eivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynnh
    egggsfqaveqvkflkklfe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5jibD (D:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jibD (D:)
    fdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfsg
    yrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqgsg
    wlkgdtpdypgpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqerivi
    aggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdkee
    ivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynnhe
    gggsfqaveqvkflkklfe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5jibE (E:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jibE (E:)
    fdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfsg
    yrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqgsg
    wlkgdtpdypepvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqerivi
    aggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdkee
    ivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynnhe
    gggsfqaveqvkflkklfe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5jibF (F:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jibF (F:)
    fdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfsg
    yrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqgsg
    wlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqeriv
    iaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdke
    eivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynnh
    egggsfqaveqvkflkklfe