PDB entry 5ji3

View 5ji3 on RCSB PDB site
Description: HslUV complex
Class: hydrolase
Keywords: AAA+ ATPase, peptidase, HSLVU, PEPTIDASE-ATPASE COMPLEX, HYDROLASE COMPLEX, hydrolase
Deposited on 2016-04-21, released 2016-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:562]
    Gene: hslV, EC55989_4410
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ji3a_
  • Chain 'B':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:562]
    Gene: hslV, EC55989_4410
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ji3b_
  • Chain 'C':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:562]
    Gene: hslV, EC55989_4410
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ji3c_
  • Chain 'D':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:562]
    Gene: hslV, EC55989_4410
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ji3d_
  • Chain 'E':
    Compound: ATP-dependent protease ATPase subunit HslU
    Species: Escherichia coli [TaxId:562]
    Gene: hslU, htpI, Z5478, ECs4858
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ji3e_
  • Chain 'F':
    Compound: ATP-dependent protease ATPase subunit HslU
    Species: Escherichia coli [TaxId:562]
    Gene: hslU, htpI, Z5478, ECs4858
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DAT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ji3A (A:)
    mttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfel
    ferklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendl
    iaigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ji3A (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ji3B (B:)
    mttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfel
    ferklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendl
    iaigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ji3B (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ji3C (C:)
    mttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfel
    ferklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendl
    iaigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ji3C (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ji3D (D:)
    mttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfel
    ferklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendl
    iaigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ji3D (D:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ji3E (E:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
    pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
    qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
    hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
    tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
    dadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ji3E (E:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftegkevdsiirdltdaavkmvrvqaieknryrae
    elaeerildvlippaepsaarqafrkklregqkikdamkllieeeaaklvnpeelkqdai
    daveqhgivfideidkicksgpdvsregvqrdllplvegctvstkhgmvktdhilfiasg
    afqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmategvnief
    tdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitidadyvskh
    ldalvadedlsrfil
    

  • Chain 'F':
    No sequence available.