PDB entry 5jhw

View 5jhw on RCSB PDB site
Description: Crystal Structure of the GDF11:Follistatin 288 complex
Class: CYTOKINE/Signaling Protein
Keywords: GDF11, follistatin, TGFbeta, Ligand, CYTOKINE-Signaling Protein complex
Deposited on 2016-04-21, released 2017-03-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Growth/differentiation factor 11
  Species: Homo sapiens [TaxId:9606]
  Gene: GDF11, BMP11
  Database cross-references and differences (RAF-indexed):
  • Uniprot O95390 (0-108)
  Domains in SCOPe 2.08: d5jhwa_
• Chain 'B':
  Compound: Growth/differentiation factor 11
  Species: Homo sapiens [TaxId:9606]
  Gene: GDF11, BMP11
  Database cross-references and differences (RAF-indexed):
  • Uniprot O95390 (0-108)
  Domains in SCOPe 2.08: d5jhwb_
• Chain 'C':
  Compound: Follistatin
  Species: Homo sapiens [TaxId:9606]
  Gene: FST
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19883 (0-287)
• Chain 'D':
  Compound: Follistatin
  Species: Homo sapiens [TaxId:9606]
  Gene: FST
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19883 (0-287)
• Heterogens: PO4, FLC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5jhwA (A:)
  nlgldcdehssesrccrypltvdfeafgwdwiiapkrykanycsgqceymfmqkyphthl
  vqqanprgsagpcctptkmspinmlyfndkqqiiygkipgmvvdrcgcs
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5jhwB (B:)
  nlgldcdehssesrccrypltvdfeafgwdwiiapkrykanycsgqceymfmqkyphthl
  vqqanprgsagpcctptkmspinmlyfndkqqiiygkipgmvvdrcgcs
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.