PDB entry 5jht

View 5jht on RCSB PDB site
Description: Apo form of influenza strain H1N1 polymerase acidic subunit N-terminal region crystallized with potassium sodium tartrate
Class: hydrolase
Keywords: Hydrolase
Deposited on 2016-04-21, released 2016-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase acidic protein
    Species: Influenza A virus [TaxId:211044]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03433 (5-54)
      • expression tag (0-4)
      • linker (55-56)
    • Uniprot P03433 (57-End)
    Domains in SCOPe 2.07: d5jhta1, d5jhta2
  • Heterogens: MN, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jhtA (A:)
    gplgsmedfvrqcfnpmivelaektmkeygedlkietnkfaaicthlevcfmysdaskhr
    feiiegrdrtmawtvvnsicnttgaekpkflpdlydykenrfieigvtrrevhiyyleka
    nkiksekthihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqse
    rgaaelalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jhtA (A:)
    gplgsmedfvrqcfnpmivelaektmkeygedlkietnkfaaicthlevcfmysdaskhr
    feiiegrdrtmawtvvnsicnttgaekpkflpdlydykenrfieigvtrrevhiyyleka
    nkiksekthihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqse
    r