PDB entry 5jhp

View 5jhp on RCSB PDB site
Description: crystal structure of the rice topless related protein 2 (tpr2) n- terminal topless domain (1-209) l179a and i195a mutant in complex with rice d53 repressor ear peptide motif
Deposited on 2016-04-21, released 2017-07-05
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein TPR1
    Species: Oryza sativa [TaxId:4530]
    Gene: TPR1, ASPR2, TPR2, Os01g0254100, LOC_Os01g15020, OsJ_01134, OSNPB_010254100, P0705D01.10-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NBT9
      • engineered mutation (178)
  • Chain 'B':
    Compound: Protein TPR1
    Species: Oryza sativa [TaxId:4530]
    Gene: TPR1, ASPR2, TPR2, Os01g0254100, LOC_Os01g15020, OsJ_01134, OSNPB_010254100, P0705D01.10-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NBT9
      • engineered mutation (178)
  • Chain 'C':
    Compound: Protein TPR1
    Species: Oryza sativa [TaxId:4530]
    Gene: TPR1, ASPR2, TPR2, Os01g0254100, LOC_Os01g15020, OsJ_01134, OSNPB_010254100, P0705D01.10-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NBT9
      • engineered mutation (178)
  • Chain 'D':
    Compound: Protein TPR1
    Species: Oryza sativa [TaxId:4530]
    Gene: TPR1, ASPR2, TPR2, Os01g0254100, LOC_Os01g15020, OsJ_01134, OSNPB_010254100, P0705D01.10-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NBT9
      • engineered mutation (178)
  • Chain 'E':
    Compound: The rice D53 EAR peptide (794-808)
    Species: Oryza sativa, synthetic [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JHP (0-End)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jhpA (A:)
    msslsrelvflilqfldeekfketvhkleqesgfffnmkyfeekvhagewdevekylsgf
    tkvddnrysmkiffeirkqkylealdrhdrakavdilvkdlkvfstfneelykeitqllt
    lenfreneqlskygdtksarsimlielkklieanplfreklvfptlkasrlrtlinqsan
    wqhqlcknprpnpdaktlftdhtctppng
    

    Sequence, based on observed residues (ATOM records):
    >5jhpA (A:)
    sslsrelvflilqfldeekfketvhkleqesgfffnmkyfeekvhagewdevekylsgft
    kvddnrysmkiffeirkqkylealdrhdrakavdilvkdlkvfstfneelykeitqlltl
    enfreneqlskygdtksarsimlielkklieanplfreklvfptlkasrlrtlinqsanw
    td
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jhpB (B:)
    msslsrelvflilqfldeekfketvhkleqesgfffnmkyfeekvhagewdevekylsgf
    tkvddnrysmkiffeirkqkylealdrhdrakavdilvkdlkvfstfneelykeitqllt
    lenfreneqlskygdtksarsimlielkklieanplfreklvfptlkasrlrtlinqsan
    wqhqlcknprpnpdaktlftdhtctppng
    

    Sequence, based on observed residues (ATOM records):
    >5jhpB (B:)
    sslsrelvflilqfldeekfketvhkleqesgfffnmkyfeekvhagewdevekylsgft
    kvddnrysmkiffeirkqkylealdrhdrakavdilvkdlkvfstfneelykeitqlltl
    enfreneqlskygdtksarsimlielkklieanplfreklvfptlkasrlrtlinqsan
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jhpC (C:)
    msslsrelvflilqfldeekfketvhkleqesgfffnmkyfeekvhagewdevekylsgf
    tkvddnrysmkiffeirkqkylealdrhdrakavdilvkdlkvfstfneelykeitqllt
    lenfreneqlskygdtksarsimlielkklieanplfreklvfptlkasrlrtlinqsan
    wqhqlcknprpnpdaktlftdhtctppng
    

    Sequence, based on observed residues (ATOM records):
    >5jhpC (C:)
    sslsrelvflilqfldeekfketvhkleqesgfffnmkyfeekvhagewdevekylsgft
    kvddnrysmkiffeirkqkylealdrhdrakavdilvkdlkvfstfneelykeitqlltl
    enfreneqlskygdtksarsimlielkklieanplfreklvfptlkasrlrtlinqsanw
    qtlftd
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jhpD (D:)
    msslsrelvflilqfldeekfketvhkleqesgfffnmkyfeekvhagewdevekylsgf
    tkvddnrysmkiffeirkqkylealdrhdrakavdilvkdlkvfstfneelykeitqllt
    lenfreneqlskygdtksarsimlielkklieanplfreklvfptlkasrlrtlinqsan
    wqhqlcknprpnpdaktlftdhtctppng
    

    Sequence, based on observed residues (ATOM records):
    >5jhpD (D:)
    sslsrelvflilqfldeekfketvhkleqesgfffnmkyfeekvhagewdevekylsgft
    kvddnrysmkiffeirkqkylealdrhdrakavdilvkdlkvfstfneelykeitqlltl
    enfreneqlskygdtksarsimlielkklieanplfreklvfptlkasrlrtlinqsanw
    qhq
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5jhpE (E:)
    dnliyldlnlqdwdd
    

    Sequence, based on observed residues (ATOM records):
    >5jhpE (E:)
    dnliyldln