PDB entry 5jgr

View 5jgr on RCSB PDB site
Description: Spin-Labeled T4 Lysozyme Construct K43V1
Class: hydrolase
Keywords: Spin label, EPR, DEER, HYDROLASE
Deposited on 2016-04-20, released 2017-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endolysin
    Species: Enterobacteria phage T4 sensu lato [TaxId:348604]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • conflict (11)
      • engineered mutation (42)
      • engineered mutation (53)
      • engineered mutation (96)
      • conflict (136)
    Domains in SCOPe 2.07: d5jgra_
  • Heterogens: V1A, CL, PO4, K, HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5jgrA (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnaacseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl