PDB entry 5jgo

View 5jgo on RCSB PDB site
Description: tRNA guanine Transglycosylase (TGT) in co-crystallized complex with allyl (2-(methylamino)-8-oxo-7,8-dihydro-1H-imidazo[4,5-g]quinazolin-6-yl)carbamate
Class: transferase
Keywords: co-crystallization, shigellosis, Prodrugs, TRANSFERASE, TRANSFERASE INHIBITOR
Deposited on 2016-04-20, released 2017-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) [TaxId:264203]
    Gene: tgt, ZMO0363
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720
      • conflict (311)
    Domains in SCOPe 2.08: d5jgoa_
  • Heterogens: 6JX, GOL, ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jgoA (A:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jgoA (A:)
    drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilg
    ntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshsr
    hmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeq
    aenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlp
    ddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlk
    pldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsq
    faqdfraryfa