PDB entry 5jgl

View 5jgl on RCSB PDB site
Description: crystal structure of gtma in complex with s-adenosylmethionine
Deposited on 2016-04-20, released 2017-03-01
The last revision was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UbiE/COQ5 family methyltransferase, putative
    Species: Aspergillus fumigatus [TaxId:746128]
    Gene: Y699_02735
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0J5Q3C4 (Start-288)
      • conflict (50)
      • conflict (159)
      • conflict (285)
  • Chain 'B':
    Compound: UbiE/COQ5 family methyltransferase, putative
    Species: Aspergillus fumigatus [TaxId:746128]
    Gene: Y699_02735
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0J5Q3C4 (Start-288)
      • conflict (50)
      • conflict (159)
      • conflict (285)
  • Heterogens: SAM, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jglA (A:)
    ghmsksdyiqnmfqtksfvdrykytekltglyaqtlvdysgvantsqkplivldnacgig
    avssvlnhtlqdeakktwkltcgdlsegmlettkrrlqdegwvnaetkivnaldtglpdg
    hythvfvafgfqsfpdanaalkecfrilasggilasstwqnfnwipimkaaietipgnlp
    fptqkefialhnagwdsesyiqseleklgfrdvkvipvpketsipideffevcmmiipyl
    lpkfwteeqreshekdvpmvlrqylqdtygangqvpleavalittglkp
    

    Sequence, based on observed residues (ATOM records):
    >5jglA (A:)
    ksfvdrykytekltglyaqtlvdysgvantsqkplivldnacgigavssvlnhtlqdeak
    ktwkltcgdlsegmlettkrrlqdegwvnaetkivnaldtglpdghythvfvafgfqsfp
    danaalkecfrilasggilasstwqnfnwipimkaaietipgnlpfptqkefialnagwd
    sesyiqseleklgfrdvkvipvpketsipideffevcmmiipyllpkfwteeqreshekd
    vpmvlrqylqdtygangqvpleavalittglkp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jglB (B:)
    ghmsksdyiqnmfqtksfvdrykytekltglyaqtlvdysgvantsqkplivldnacgig
    avssvlnhtlqdeakktwkltcgdlsegmlettkrrlqdegwvnaetkivnaldtglpdg
    hythvfvafgfqsfpdanaalkecfrilasggilasstwqnfnwipimkaaietipgnlp
    fptqkefialhnagwdsesyiqseleklgfrdvkvipvpketsipideffevcmmiipyl
    lpkfwteeqreshekdvpmvlrqylqdtygangqvpleavalittglkp
    

    Sequence, based on observed residues (ATOM records):
    >5jglB (B:)
    fvdrykytekltglyaqtlvdysgvantsqkplivldnacgigavssvlnhtlqdeakkt
    wkltcgdlsegmlettkrrlqdegwvnaetkivnaldtglpdghythvfvafgfqsfpda
    naalkecfrilasggilasstwqnfnwipimkaaietipgnlpfptqkefialhnagwds
    esyiqseleklgfrdvkvipvpketsipideffevcmmiipyllpkfwteeqreshekdv
    pmvlrqylqdtyqvpleavalittglkp