PDB entry 5jg6

View 5jg6 on RCSB PDB site
Description: APC11-Ubv shows role of noncovalent RING-Ubiquitin interactions in processive multiubiquitination and Ubiquitin chain elongation by APC/C
Class: cell cycle
Keywords: RING Ubiquitin Cell Cycle Anaphase-promoting complex-Cyclosome, CELL CYCLE
Deposited on 2016-04-19, released 2016-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anaphase-promoting complex subunit 11
    Species: Homo sapiens [TaxId:9606]
    Gene: ANAPC11, HSPC214
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (5-End)
      • expression tag (4)
      • conflict (9)
      • conflict (13-14)
      • conflict (47)
      • conflict (49)
      • conflict (52)
      • conflict (54)
      • conflict (69)
      • conflict (71)
      • conflict (73)
      • conflict (75-76)
      • conflict (78-79)
    Domains in SCOPe 2.06: d5jg6b1, d5jg6b2
  • Chain 'C':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47
      • conflict (9)
      • conflict (13-14)
      • conflict (47)
      • conflict (49)
      • conflict (52)
      • conflict (54)
      • conflict (69)
      • conflict (71)
      • conflict (73)
      • conflict (75-76)
      • conflict (78-79)
    Domains in SCOPe 2.06: d5jg6c_
  • Chain 'D':
    Compound: Anaphase-promoting complex subunit 11
    Species: Homo sapiens [TaxId:9606]
    Gene: ANAPC11, HSPC214
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jg6B (B:)
    gsggsgmqilvktprgktitlevepsdtienvkakiqdkegippdqqilffavkrledgr
    tlsdyniqkksslllamrvpgkmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jg6B (B:)
    sgmqilvktprgktitlevepsdtienvkakiqdkegippdqqilffavkrledgrtlsd
    yniqkksslllamrvpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jg6C (C:)
    gsggsgmqilvktprgktitlevepsdtienvkakiqdkegippdqqilffavkrledgr
    tlsdyniqkksslllamrvpgkmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jg6C (C:)
    mqilvktprgktitlevepsdtienvkakiqdkegippdqqilffavkrledgrtlsdyn
    iqkksslllamrvpg
    

  • Chain 'D':
    No sequence available.