PDB entry 5jg6
View 5jg6 on RCSB PDB site
Description: APC11-Ubv shows role of noncovalent RING-Ubiquitin interactions in processive multiubiquitination and Ubiquitin chain elongation by APC/C
Class: cell cycle
Keywords: RING Ubiquitin Cell Cycle Anaphase-promoting complex-Cyclosome, CELL CYCLE
Deposited on
2016-04-19, released
2016-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated
2016-06-15, with a file datestamp of
2016-06-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Anaphase-promoting complex subunit 11
Species: Homo sapiens [TaxId:9606]
Gene: ANAPC11, HSPC214
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Polyubiquitin-B
Species: Homo sapiens [TaxId:9606]
Gene: UBB
Database cross-references and differences (RAF-indexed):
- Uniprot P0CG47 (5-End)
- expression tag (4)
- conflict (9)
- conflict (13-14)
- conflict (47)
- conflict (49)
- conflict (52)
- conflict (54)
- conflict (69)
- conflict (71)
- conflict (73)
- conflict (75-76)
- conflict (78-79)
Domains in SCOPe 2.06: d5jg6b1, d5jg6b2 - Chain 'C':
Compound: Polyubiquitin-B
Species: Homo sapiens [TaxId:9606]
Gene: UBB
Database cross-references and differences (RAF-indexed):
- Uniprot P0CG47
- conflict (9)
- conflict (13-14)
- conflict (47)
- conflict (49)
- conflict (52)
- conflict (54)
- conflict (69)
- conflict (71)
- conflict (73)
- conflict (75-76)
- conflict (78-79)
Domains in SCOPe 2.06: d5jg6c_ - Chain 'D':
Compound: Anaphase-promoting complex subunit 11
Species: Homo sapiens [TaxId:9606]
Gene: ANAPC11, HSPC214
Database cross-references and differences (RAF-indexed):
- Heterogens: ZN, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>5jg6B (B:)
gsggsgmqilvktprgktitlevepsdtienvkakiqdkegippdqqilffavkrledgr
tlsdyniqkksslllamrvpgkmk
Sequence, based on observed residues (ATOM records): (download)
>5jg6B (B:)
sgmqilvktprgktitlevepsdtienvkakiqdkegippdqqilffavkrledgrtlsd
yniqkksslllamrvpg
- Chain 'C':
Sequence, based on SEQRES records: (download)
>5jg6C (C:)
gsggsgmqilvktprgktitlevepsdtienvkakiqdkegippdqqilffavkrledgr
tlsdyniqkksslllamrvpgkmk
Sequence, based on observed residues (ATOM records): (download)
>5jg6C (C:)
mqilvktprgktitlevepsdtienvkakiqdkegippdqqilffavkrledgrtlsdyn
iqkksslllamrvpg
- Chain 'D':
No sequence available.