PDB entry 5jg4

View 5jg4 on RCSB PDB site
Description: structure of the effector protein lpir1 (lpg0634) from legionella pneumophila
Deposited on 2016-04-19, released 2016-05-04
The last revision was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: effector protein LpiR1
    Species: Legionella pneumophila [TaxId:446]
    Gene: lpymg_00644
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: effector protein LpiR1
    Species: Legionella pneumophila [TaxId:446]
    Gene: lpymg_00644
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, FLC, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jg4A (A:)
    snatfvlkefdalkshfndtvkiilqrekkdkiedlpnprkeelqfltavlnqleakide
    lkprslasyvhvfygamllvckdvennlrvmekkensllftrlmdgmgisdeniptseqn
    imfyrglnkflnfiyesndsrkglkkehflqvlslkkiyslaklsyeqeeaaennalakl
    tadgktkanansfhvekpidssiveqfkswdemkgalhqlildelsdknvakisalsqar
    saqlkflqtmaeqldkipnqslepsekmailagamyivrgqiaqeygkdplsndkisatv
    ihtglstilhanadccedkevliaaankfirhmvierpeqsnkkitkesvrennmfsdia
    gfqlisvltliqnmiktcrtdaieacvtkrkeelealkpkkegysiassvtgyvgswfkk
    apsmseedeeddlkdqntaeetskptv
    

    Sequence, based on observed residues (ATOM records):
    >5jg4A (A:)
    tfvlkefdalkshfndtvkiilqrekkdkiedlpnprkeelqfltavlnqleakidelkp
    rslasyvhvfygamllvckdvennlrvmekkensllftrlmdgmgisdeniptseqnimf
    yrglnkflnfiyesndsrkglkkehflqvlslkkiyslaklsyeqeeaaennalakltad
    gktkanansfhvekpidssiveqfkswdemkgalhqlildelsdknvakisalsqarsaq
    lkflqtmaeqldkipnqslepsekmailagamyivrgqiaqeygkdplsndkisatviht
    glstilhanadccedkevliaaankfirhmvierpeqsnkkitkesvrennmfsdiagfq
    lisvltliqnmiktcrtdaieacvtkrkeelealk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jg4B (B:)
    snatfvlkefdalkshfndtvkiilqrekkdkiedlpnprkeelqfltavlnqleakide
    lkprslasyvhvfygamllvckdvennlrvmekkensllftrlmdgmgisdeniptseqn
    imfyrglnkflnfiyesndsrkglkkehflqvlslkkiyslaklsyeqeeaaennalakl
    tadgktkanansfhvekpidssiveqfkswdemkgalhqlildelsdknvakisalsqar
    saqlkflqtmaeqldkipnqslepsekmailagamyivrgqiaqeygkdplsndkisatv
    ihtglstilhanadccedkevliaaankfirhmvierpeqsnkkitkesvrennmfsdia
    gfqlisvltliqnmiktcrtdaieacvtkrkeelealkpkkegysiassvtgyvgswfkk
    apsmseedeeddlkdqntaeetskptv
    

    Sequence, based on observed residues (ATOM records):
    >5jg4B (B:)
    tfvlkefdalkshfndtvkiilqrekkdkiedlpnprkeelqfltavlnqleakidelkp
    rslasyvhvfygamllvckdvennlrvmekkensllftrlmdgmgisdeniptseqnimf
    yrglnkflnfiyesndsrkglkkehflqvlslkkiyslaklsyeqeeaaennalakltad
    gktkanansfhvekpidssiveqfkswdemkgalhqlildelsdknvakisalsqarsaq
    lkflqtmaeqldkipnqslepsekmailagamyivrgqiaqeygkdplsndkisatviht
    glstilhanadccedkevliaaankfirhmvierpeqsnkkitkesvrennmfsdiagfq
    lisvltliqnmiktcrtdaieacvtkrkeelealk