PDB entry 5jg3

View 5jg3 on RCSB PDB site
Description: Human carbonic anhydrase II (121T/N67Q) complexed with benzo[d]thiazole-2-sulfonamide
Class: Lyase
Keywords: Anhydrase, Mutant, Hydrophobic, Lyase
Deposited on 2016-04-19, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (1-258)
      • expression tag (0)
      • engineered mutation (65)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d5jg3b1, d5jg3b2
  • Heterogens: EVF, ZN, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jg3B (B:)
    ahhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslriln
    nghafqvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlt
    hwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdpr
    gllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmv
    dnwrpaqplknrqikasfk