PDB entry 5jg0

View 5jg0 on RCSB PDB site
Description: Staphylococcus aureus Dihydrofolate Reductase complexed with beta-NADPH and UCP1191
Class: oxidoreductase
Keywords: Oxidoreductase, Dihydrofolate Reductase, NADPH, Zwitterion, Antibiotics
Deposited on 2016-04-19, released 2017-04-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dihydrofolate reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jg0x_
  • Heterogens: UC9, NAP, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jg0X (X:)
    tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
    vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
    tffppytfedwevassvegkldekntiphtflhlirk