PDB entry 5jfi

View 5jfi on RCSB PDB site
Description: crystal structure of a tdif-tdr complex
Deposited on 2016-04-19, released 2017-03-29
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leucine-rich repeat receptor-like protein kinase TDR
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: TDR, PXY, At5g61480, MCI2.4
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Leucine-rich repeat receptor-like protein kinase TDR
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: TDR, PXY, At5g61480, MCI2.4
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: cle41
    Species: ARABIDOPSIS THALIANA, synthetic [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: cle41
    Species: ARABIDOPSIS THALIANA, synthetic [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jfiA (A:)
    lkfspqllsllslktslsgppsafqdwkvpvngqndavwcswsgvvcdnvtaqvisldls
    hrnlsgripiqirylssllylnlsgnslegsfptsifdltklttldisrnsfdssfppgi
    sklkflkvfnafsnnfegllpsdvsrlrfleelnfggsyfegeipaaygglqrlkfihla
    gnvlggklpprlglltelqhmeigynhfngnipsefallsnlkyfdvsncslsgslpqel
    gnlsnletlflfqngftgeipesysnlkslklldfssnqlsgsipsgfstlknltwlsli
    snnlsgevpegigelpelttlflwnnnftgvlphklgsngkletmdvsnnsftgtipssl
    chgnklyklilfsnmfegelpksltrceslwrfrsqnnrlngtipigfgslrnltfvdls
    nnrftdqipadfatapvlqylnlstnffhrklpeniwkapnlqifsasfsnligeipnyv
    gcksfyrielqgnslngtipwdighcekllclnlsqnhlngiipweistlpsiadvdlsh
    nlltgtipsdfgssktittfnvsynqligpipsgsfahlnpsffssneglcgdlvgkpcn
    sdrfnagnadidg
    

    Sequence, based on observed residues (ATOM records):
    >5jfiA (A:)
    lslktslskvpvngqndavwcswsgvvcdnvtaqvisldlshrnlsgripiqirylssll
    ylnlsgnslegsfptsifdltklttldisrnsfdssfppgisklkflkvfnafsnnfegl
    lpsdvsrlrfleelnfggsyfegeipaaygglqrlkfihlagnvlggklpprlglltelq
    hmeigynhfngnipsefallsnlkyfdvsncslsgslpqelgnlsnletlflfqngftge
    ipesysnlkslklldfssnqlsgsipsgfstlknltwlslisnnlsgevpegigelpelt
    tlflwnnnftgvlphklgsngkletmdvsnnsftgtipsslchgnklyklilfsnmfege
    lpksltrceslwrfrsqnnrlngtipigfgslrnltfvdlsnnrftdqipadfatapvlq
    ylnlstnffhrklpeniwkapnlqifsasfsnligeipnyvgcksfyrielqgnslngti
    pwdighcekllclnlsqnhlngiipweistlpsiadvdlshnlltgtipsdfgssktitt
    fnvsynqligpipsgsfahlnpsffssneglcgdlvg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jfiB (B:)
    lkfspqllsllslktslsgppsafqdwkvpvngqndavwcswsgvvcdnvtaqvisldls
    hrnlsgripiqirylssllylnlsgnslegsfptsifdltklttldisrnsfdssfppgi
    sklkflkvfnafsnnfegllpsdvsrlrfleelnfggsyfegeipaaygglqrlkfihla
    gnvlggklpprlglltelqhmeigynhfngnipsefallsnlkyfdvsncslsgslpqel
    gnlsnletlflfqngftgeipesysnlkslklldfssnqlsgsipsgfstlknltwlsli
    snnlsgevpegigelpelttlflwnnnftgvlphklgsngkletmdvsnnsftgtipssl
    chgnklyklilfsnmfegelpksltrceslwrfrsqnnrlngtipigfgslrnltfvdls
    nnrftdqipadfatapvlqylnlstnffhrklpeniwkapnlqifsasfsnligeipnyv
    gcksfyrielqgnslngtipwdighcekllclnlsqnhlngiipweistlpsiadvdlsh
    nlltgtipsdfgssktittfnvsynqligpipsgsfahlnpsffssneglcgdlvgkpcn
    sdrfnagnadidg
    

    Sequence, based on observed residues (ATOM records):
    >5jfiB (B:)
    lslktslskvpvngqndavwcswsgvvcdnvtaqvisldlshrnlsgripiqirylssll
    ylnlsgnslegsfptsifdltklttldisrnsfdssfppgisklkflkvfnafsnnfegl
    lpsdvsrlrfleelnfggsyfegeipaaygglqrlkfihlagnvlggklpprlglltelq
    hmeigynhfngnipsefallsnlkyfdvsncslsgslpqelgnlsnletlflfqngftge
    ipesysnlkslklldfssnqlsgsipsgfstlknltwlslisnnlsgevpegigelpelt
    tlflwnnnftgvlphklgsngkletmdvsnnsftgtipsslchgnklyklilfsnmfege
    lpksltrceslwrfrsqnnrlngtipigfgslrnltfvdlsnnrftdqipadfatapvlq
    ylnlstnffhrklpeniwkapnlqifsasfsnligeipnyvgcksfyrielqgnslngti
    pwdighcekllclnlsqnhlngiipweistlpsiadvdlshnlltgtipsdfgssktitt
    fnvsynqligpipsgsfahlnpsffssneglcgdlvg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5jfiC (C:)
    hevpsgpnpisn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >5jfiD (D:)
    hevpsgpnpisn