PDB entry 5jer

View 5jer on RCSB PDB site
Description: Structure of Rotavirus NSP1 bound to IRF-3
Class: immune system
Keywords: Viral Immunity, IMMUNE SYSTEM
Deposited on 2016-04-18, released 2016-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jera_
  • Chain 'B':
    Compound: Rotavirus NSP1 peptide
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JER
  • Chain 'C':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jerc_
  • Chain 'D':
    Compound: Rotavirus NSP1 peptide
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JER
  • Chain 'E':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jere_
  • Chain 'F':
    Compound: Rotavirus NSP1 peptide
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JER
  • Chain 'G':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jerg_
  • Chain 'H':
    Compound: Rotavirus NSP1 peptide
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JER

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jerA (A:)
    sefenplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtl
    pdpgmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsgh
    gpdgevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmv
    kvvptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpg
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jerA (A:)
    enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
    gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
    gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
    ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jerC (C:)
    sefenplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtl
    pdpgmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsgh
    gpdgevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmv
    kvvptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpg
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jerC (C:)
    enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
    gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
    gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
    ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5jerE (E:)
    sefenplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtl
    pdpgmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsgh
    gpdgevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmv
    kvvptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpg
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jerE (E:)
    enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
    gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
    gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
    ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5jerG (G:)
    sefenplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtl
    pdpgmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsgh
    gpdgevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmv
    kvvptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpg
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jerG (G:)
    enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
    gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
    gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
    ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq
    

  • Chain 'H':
    No sequence available.