PDB entry 5jem

View 5jem on RCSB PDB site
Description: Complex of IRF-3 with CBP
Class: immune system
Keywords: Innate Immunity, Signaling, IMMUNE SYSTEM
Deposited on 2016-04-18, released 2016-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14653 (Start-212)
      • conflict (200)
      • conflict (210)
  • Chain 'B':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14653 (Start-212)
      • conflict (200)
      • conflict (210)
  • Chain 'C':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jemc_
  • Chain 'D':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jemd_
  • Chain 'E':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14653 (Start-212)
      • conflict (200)
      • conflict (210)
  • Chain 'F':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jemf_
  • Chain 'G':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14653 (Start-212)
      • conflict (200)
      • conflict (210)
  • Chain 'H':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jemh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jemC (C:)
    salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jemC (C:)
    salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrta
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5jemD (D:)
    salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jemD (D:)
    salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrta
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5jemF (F:)
    salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jemF (F:)
    salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrta
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5jemH (H:)
    salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jemH (H:)
    salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrta