PDB entry 5jej

View 5jej on RCSB PDB site
Description: Phosphorylated STING in complex with IRF-3 CTD
Class: immune system
Keywords: Innate Immunity, Signaling, IMMUNE SYSTEM
Deposited on 2016-04-18, released 2016-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jeja_
  • Chain 'B':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jejb_
  • Chain 'C':
    Compound: Stimulator of interferon genes protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TMEM173, ERIS, MITA, STING
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86WV6 (Start-38)
      • conflict (37)
  • Chain 'D':
    Compound: Stimulator of interferon genes protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TMEM173, ERIS, MITA, STING
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Stimulator of interferon genes protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TMEM173, ERIS, MITA, STING
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86WV6 (Start-38)
      • conflict (37)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jejA (A:)
    sefenplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtl
    pdpgmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsgh
    gpdgevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmv
    kvvptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpg
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jejA (A:)
    enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
    gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
    gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
    ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jejB (B:)
    sefenplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtl
    pdpgmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsgh
    gpdgevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmv
    kvvptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpg
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jejB (B:)
    enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
    gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
    gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
    ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.