PDB entry 5jee

View 5jee on RCSB PDB site
Description: apo-structure of humanised rada-mutant humrada26f
Deposited on 2016-04-18, released 2016-10-19
The last revision was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair and recombination protein radA
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: radA, PF1926
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74036 (Start-230)
      • engineered mutation (60-63)
      • engineered mutation (75-76)
      • engineered mutation (91-95)
      • engineered mutation (112)
      • engineered mutation (114-115)
      • engineered mutation (181)
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jeeA (A:)
    matigristgsksldkllgggietqaitevfgefgsgktqlahtlavmvqlppeegglng
    kamyidtentfrperlleiaqnrgldpdevldnvayarafnsnhqmllvqqasdmmkell
    ntdrpvkllivdsltshfrseyigrgalaerqqklakhladlhrlanlydiavfvtnqvq
    angghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

    Sequence, based on observed residues (ATOM records):
    >5jeeA (A:)
    tigristgsksldkllgggietqaitevfgefgsgktqlahtlavmvqlppeegglngka
    myidtentfrperlleiaqnrgldpdevldnvayarafnsnhqmllvqqasdmmkellnt
    drpvkllivdsltshfrseyigrgalaerqqklakhladlhrlanlydiavfvtnqvqan
    gghsatlrvylrkgkggkriarligeavfsitekgied