PDB entry 5je8

View 5je8 on RCSB PDB site
Description: The crystal structure of Bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD
Class: oxidoreductase
Keywords: dehydrogenase, OXIDOREDUCTASE
Deposited on 2016-04-18, released 2016-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Gene: BC_2289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5je8a1, d5je8a2
  • Chain 'B':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Gene: BC_2289
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81DR6 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.07: d5je8b1, d5je8b2, d5je8b3
  • Chain 'C':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Gene: BC_2289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5je8c1, d5je8c2
  • Chain 'D':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Gene: BC_2289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5je8d1, d5je8d2
  • Heterogens: NAD, EPE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5je8A (A:)
    gsakdpmkkigfiglgnmglpmsknlvksgytvygvdlnkeaeasfekeggiiglsiskl
    aetcdvvftslpspraveavyfgaeglfenghsnvvfidtstvspqlnkqleeaakekkv
    dflaapvsggvigaenrtltfmvggskdvyektesimgvlganifhvseqidsgttvkli
    nnlligfytagvsealtlakknnmdldkmfdilnvsygqsriyernyksfiapenyepgf
    tvnllkkdlgfavdlakeselhlpvsemllnvydeasqagygendmaalykkvseqlisn
    qk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5je8A (A:)
    mkkigfiglgnmglpmsknlvksgytvygvdlnkeaeasfekeggiiglsisklaetcdv
    vftslpspraveavyfgaeglfenghsnvvfidtstvspqlnkqleeaakekkvdflaap
    vsggvigaenrtltfmvggskdvyektesimgvlganifhvseqidsgttvklinnllig
    fytagvsealtlakknnmdldkmfdilnvsygqsriyernyksfiapenyepgftvnllk
    kdlgfavdlakeselhlpvsemllnvydeasqagygendmaalykkvseql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5je8B (B:)
    gsakdpmkkigfiglgnmglpmsknlvksgytvygvdlnkeaeasfekeggiiglsiskl
    aetcdvvftslpspraveavyfgaeglfenghsnvvfidtstvspqlnkqleeaakekkv
    dflaapvsggvigaenrtltfmvggskdvyektesimgvlganifhvseqidsgttvkli
    nnlligfytagvsealtlakknnmdldkmfdilnvsygqsriyernyksfiapenyepgf
    tvnllkkdlgfavdlakeselhlpvsemllnvydeasqagygendmaalykkvseqlisn
    qk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5je8B (B:)
    dpmkkigfiglgnmglpmsknlvksgytvygvdlnkeaeasfekeggiiglsisklaetc
    dvvftslpspraveavyfgaeglfenghsnvvfidtstvspqlnkqleeaakekkvdfla
    apvsggvigaenrtltfmvggskdvyektesimgvlganifhvseqidsgttvklinnll
    igfytagvsealtlakknnmdldkmfdilnvsygqsriyernyksfiapenyepgftvnl
    lkkdlgfavdlakeselhlpvsemllnvydeasqagygendmaalykkvseqli
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5je8C (C:)
    gsakdpmkkigfiglgnmglpmsknlvksgytvygvdlnkeaeasfekeggiiglsiskl
    aetcdvvftslpspraveavyfgaeglfenghsnvvfidtstvspqlnkqleeaakekkv
    dflaapvsggvigaenrtltfmvggskdvyektesimgvlganifhvseqidsgttvkli
    nnlligfytagvsealtlakknnmdldkmfdilnvsygqsriyernyksfiapenyepgf
    tvnllkkdlgfavdlakeselhlpvsemllnvydeasqagygendmaalykkvseqlisn
    qk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5je8C (C:)
    kkigfiglgnmglpmsknlvksgytvygvdlnkeaeasfekeggiiglsisklaetcdvv
    ftslpspraveavyfgaeglfenghsnvvfidtstvspqlnkqleeaakekkvdflaapv
    sggvigaenrtltfmvggskdvyektesimgvlganifhvseqidsgttvklinnlligf
    ytagvsealtlakknnmdldkmfdilnvsygqsriyernyksfiapenyepgftvnllkk
    dlgfavdlakeselhlpvsemllnvydeasqagygendmaalykkvseq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5je8D (D:)
    gsakdpmkkigfiglgnmglpmsknlvksgytvygvdlnkeaeasfekeggiiglsiskl
    aetcdvvftslpspraveavyfgaeglfenghsnvvfidtstvspqlnkqleeaakekkv
    dflaapvsggvigaenrtltfmvggskdvyektesimgvlganifhvseqidsgttvkli
    nnlligfytagvsealtlakknnmdldkmfdilnvsygqsriyernyksfiapenyepgf
    tvnllkkdlgfavdlakeselhlpvsemllnvydeasqagygendmaalykkvseqlisn
    qk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5je8D (D:)
    mkkigfiglgnmglpmsknlvksgytvygvdlnkeaeasfekeggiiglsisklaetcdv
    vftslpspraveavyfgaeglfenghsnvvfidtstvspqlnkqleeaakekkvdflaap
    vsggvigaenrtltfmvggskdvyektesimgvlganifhvseqidsgttvklinnllig
    fytagvsealtlakknnmdldkmfdilnvsygqsriyernyksfiapenyepgftvnllk
    kdlgfavdlakeselhlpvsemllnvydeasqagygendmaalykkvseqli