PDB entry 5je2

View 5je2 on RCSB PDB site
Description: crystal structure of burkholderia glumae toxa y7f mutant with bound s- adenosylhomocysteine (sah)
Deposited on 2016-04-17, released 2016-05-11
The last revision was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl transferase
    Species: Burkholderia glumae [TaxId:337]
    Gene: toxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LBJ0 (Start-246)
      • engineered mutation (8)
  • Chain 'B':
    Compound: methyl transferase
    Species: Burkholderia glumae [TaxId:337]
    Gene: toxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LBJ0 (Start-246)
      • engineered mutation (8)
  • Heterogens: SAH, DMS, PG4, TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5je2A (A:)
    ghmsttarfdsigglfedftqsaaqraievrtifhmigdvsgksvldlacgfgffgreiy
    rrgaakvvgvdisekmielareesrkygdplefhvrdvanmeplgqfdlvnaawlfnyad
    svenlrkmfkvvraslkpdgklvaytvdpdfslakgnfakygvnvlnerawgpgyrhdae
    fvtdppsqfsfyrwsradyesaiadagfshfewqkplleaddiathppgfwdvfqnnclq
    tglvckp
    

    Sequence, based on observed residues (ATOM records):
    >5je2A (A:)
    arfdsigglfedftqsaaqraievrtifhmigdvsgksvldlacgfgffgreiyrrgaak
    vvgvdisekmielareesrkygdplefhvrdvanmeplgqfdlvnaawlfnyadsvenlr
    kmfkvvraslkpdgklvaytvdpdfslakgnfakygvnvlnerawgpgyrhdaefvtdpp
    sqfsfyrwsradyesaiadagfshfewqkplleaddiathppgfwdvfqnnclqtglvck
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5je2B (B:)
    ghmsttarfdsigglfedftqsaaqraievrtifhmigdvsgksvldlacgfgffgreiy
    rrgaakvvgvdisekmielareesrkygdplefhvrdvanmeplgqfdlvnaawlfnyad
    svenlrkmfkvvraslkpdgklvaytvdpdfslakgnfakygvnvlnerawgpgyrhdae
    fvtdppsqfsfyrwsradyesaiadagfshfewqkplleaddiathppgfwdvfqnnclq
    tglvckp
    

    Sequence, based on observed residues (ATOM records):
    >5je2B (B:)
    arfdsigglfedftqsaaqraievrtifhmigdvsgksvldlacgfgffgreiyrrgaak
    vvgvdisekmielareesrkygdplefhvrdvanmeplgqfdlvnaawlfnyadsvenlr
    kmfkvvraslkpdgklvaytvdpdfslakgnfakygvnvlnerawgpgyrhdaefvtdpp
    sqfsfyrwsradyesaiadagfshfewqkplleaddiathppgfwdvfqnnclqtglvck
    p