PDB entry 5jdu

View 5jdu on RCSB PDB site
Description: crystal structure for human thrombin mutant d189a
Deposited on 2016-04-17, released 2016-07-13
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Thrombin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-258)
      • engineered mutation (198)
  • Chain 'C':
    Compound: Thrombin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Thrombin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-End)
      • engineered mutation (198)
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jduA (A:)
    sgeadcglrplfekksledkterellesyidgr
    

    Sequence, based on observed residues (ATOM records):
    >5jduA (A:)
    sgeadcglrplfekksledkterellesyi
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jduB (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgaacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records):
    >5jduB (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnsvlqvvnlpiverpvckdstriritdnmfcagykpde
    gkrgaacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvi
    dqfge
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jduC (C:)
    sgeadcglrplfekksledkterellesyidgr
    

    Sequence, based on observed residues (ATOM records):
    >5jduC (C:)
    adcglrplfekksledkterellesyidg
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jduD (D:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgaacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records):
    >5jduD (D:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnkgqpsvlqvvnlpiverpvckdstriritdnmfcagy
    kpdegkrgaacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwi
    qkvidqf