PDB entry 5jdb

View 5jdb on RCSB PDB site
Description: Binding specificity of P[8] VP8* proteins of rotavirus vaccine strains with histo-blood group antigens
Class: viral protein
Keywords: rotavirus, VP8, vaccine, VIRAL PROTEIN
Deposited on 2016-04-16, released 2016-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-13, with a file datestamp of 2016-07-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jdba_
  • Chain 'B':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jdbb_
  • Chain 'C':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jdbc_
  • Chain 'D':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jdbd_
  • Chain 'E':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jdbe_
  • Chain 'F':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jdbf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jdbA (A:)
    ildgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfg
    enkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetpra
    ttdssntanlndisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jdbB (B:)
    ildgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfg
    enkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetpra
    ttdssntanlndisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jdbC (C:)
    ildgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfg
    enkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetpra
    ttdssntanlndisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jdbD (D:)
    ildgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfg
    enkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetpra
    ttdssntanlndisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jdbE (E:)
    ildgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfg
    enkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetpra
    ttdssntanlndisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jdbF (F:)
    ildgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfg
    enkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetpra
    ttdssntanlndisiiihsefyiiprsqeskcneyinngl