PDB entry 5jd2

View 5jd2 on RCSB PDB site
Description: SFX structure of corestreptavidin-selenobiotin complex
Class: Biotin binding protein
Keywords: SAD, SFX, FEL, streptavidin, Biotin binding protein
Deposited on 2016-04-15, released 2016-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jd2a_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jd2b_
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jd2c_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jd2d_
  • Heterogens: BYY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jd2A (A:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jd2A (A:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jd2B (B:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jd2B (B:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jd2C (C:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5jd2D (D:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jd2D (D:)
    gitgtwynqlgstfivtagadgaltgtyesavesryvltgrydsapatdgsgtalgwtva
    wknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk