PDB entry 5jcz

View 5jcz on RCSB PDB site
Description: Rab11 bound to MyoVa-GTD
Class: motor protein
Keywords: myosin, complex, Rab, motor cargo recognition, motor protein
Deposited on 2016-04-15, released 2016-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11A, RAB11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jcza_
  • Chain 'B':
    Compound: Unconventional myosin-Va
    Species: Homo sapiens [TaxId:9606]
    Gene: MYO5A, MYH12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jczb_
  • Chain 'C':
    Compound: Unconventional myosin-Va
    Species: Homo sapiens [TaxId:9606]
    Gene: MYO5A, MYH12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jczc_
  • Chain 'D':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11A, RAB11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jczd_
  • Chain 'E':
    Compound: Unconventional myosin-Va
    Species: Homo sapiens [TaxId:9606]
    Gene: MYO5A, MYH12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jcze_
  • Chain 'I':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11A, RAB11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jczi_
  • Heterogens: MG, GDP, BEF, EDO, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jczA (A:)
    gamgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgk
    tikaqiwdtagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsniv
    imlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jczA (A:)
    deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
    dtagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
    sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jczB (B:)
    gamgsvniprkekdfqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvr
    hadylnddqkvrslltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfm
    khntsrqnehcltnfdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqgv
    sgvkptglrkrtssiadegtytldsilrqlnsfhsvmcqhgmdpelikqvvkqmfyiiga
    itlnnlllrkdmcswskgmqirynvsqleewlrdknlmnsgaketlepliqaaqllqvkk
    ktdddaeaicsmcnalttaqivkvlnlytpvnefeervsvsfirtiqmrlrdrkdspqll
    mdakhifpvtfpfnpsslaletiqipaslglgfisrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jczB (B:)
    fqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrsl
    ltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehcltn
    fdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqggtytldsilrqlnsf
    hsvmcqhgmdpelikqvvkqmfyiigaitlnnlllrkdmcswskgmqirynvsqleewlr
    dknlmnsgaketlepliqaaqllqvkkktdddaeaicsmcnalttaqivkvlnlytpvne
    feervsvsfirtiqmrlrdrkdspqllmdakhifpvtfpfnpsslaletiqipaslglgf
    isrv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jczC (C:)
    gamgsvniprkekdfqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvr
    hadylnddqkvrslltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfm
    khntsrqnehcltnfdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqgv
    sgvkptglrkrtssiadegtytldsilrqlnsfhsvmcqhgmdpelikqvvkqmfyiiga
    itlnnlllrkdmcswskgmqirynvsqleewlrdknlmnsgaketlepliqaaqllqvkk
    ktdddaeaicsmcnalttaqivkvlnlytpvnefeervsvsfirtiqmrlrdrkdspqll
    mdakhifpvtfpfnpsslaletiqipaslglgfisrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jczC (C:)
    kdfqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvr
    slltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehcl
    tnfdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqtytldsilrqlnsf
    hsvmcqhgmdpelikqvvkqmfyiigaitlnnlllrkdmcswskgmqirynvsqleewlr
    dknlmnsgaketlepliqaaqllqvkkktdddaeaicsmcnalttaqivkvlnlytpvne
    feervsvsfirtiqmrlrdrkdspqllmdakhifpvtfpfnpsslaletiqipaslglgf
    isrv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5jczD (D:)
    gamgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgk
    tikaqiwdtagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsniv
    imlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jczD (D:)
    ddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqi
    wdtagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgn
    ksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5jczE (E:)
    gamgsvniprkekdfqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvr
    hadylnddqkvrslltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfm
    khntsrqnehcltnfdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqgv
    sgvkptglrkrtssiadegtytldsilrqlnsfhsvmcqhgmdpelikqvvkqmfyiiga
    itlnnlllrkdmcswskgmqirynvsqleewlrdknlmnsgaketlepliqaaqllqvkk
    ktdddaeaicsmcnalttaqivkvlnlytpvnefeervsvsfirtiqmrlrdrkdspqll
    mdakhifpvtfpfnpsslaletiqipaslglgfisrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jczE (E:)
    fqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrsl
    ltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehcltn
    fdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetgtytldsilrqlnsfhsv
    mcqhgmdpelikqvvkqmfyiigaitlnnlllrkdmcswskgmqirynvsqleewlrdkn
    lmnsgaketlepliqaaqllqvkkktdddaeaicsmcnalttaqivkvlnlytpvnefee
    rvsvsfirtiqmrlrdrkdspqllmdakhifpvtfpfnpsslaletiqipaslglgfisr
    v
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5jczI (I:)
    gamgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgk
    tikaqiwdtagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsniv
    imlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jczI (I:)
    lfkvvligdsgvgksnllsrftrnefnleskstigvefatkaqiwdtagqeraitsayyr
    gagallvydiakhltyenverwlkelrdhadsvimlvgnksdrhlravptearafaekng
    lsfietsaldstnveaafqtilteiyr