PDB entry 5jcy

View 5jcy on RCSB PDB site
Description: spir2-gtbm bound to myova-gtd
Deposited on 2016-04-15, released 2016-09-28
The last revision was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Unconventional myosin-Va
    Species: Homo sapiens [TaxId:9606]
    Gene: MYO5A, MYH12
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protein spire homolog 2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jcyA (A:)
    gamgsvniprkekdfqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvr
    hadylnddqkvrslltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfm
    khntsrqnehcltnfdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqgv
    sgvkptglrkrtssiadegtytldsilrqlnsfhsvmcqhgmdpelikqvvkqmfyiiga
    itlnnlllrkdmcswskgmqirynvsqleewlrdknlmnsgaketlepliqaaqllqvkk
    ktdddaeaicsmcnalttaqivkvlnlytpvnefeervsvsfirtiqmrlrdrkdspqll
    mdakhifpvtfpfnpsslaletiqipaslglgfisrv
    

    Sequence, based on observed residues (ATOM records):
    >5jcyA (A:)
    ekdfqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkv
    rslltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehc
    ltnfdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehettssiadegtytldsi
    lrqlnsfhsvmcqhgmdpelikqvvkqmfyiigaitlnnlllrkdmcswskgmqirynvs
    qleewlrdknlmnsgaketlepliqaaqllqvkkktdddaeaicsmcnalttaqivkvln
    lytpvnefeervsvsfirtiqmrlrdrkdspqllmdakhifpvtfpfnpsslaletiqip
    aslglgfisrv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jcyB (B:)
    qrprprvllkaptlaemeemntseeee
    

    Sequence, based on observed residues (ATOM records):
    >5jcyB (B:)
    rprvllkaptlaemeem