PDB entry 5jcx

View 5jcx on RCSB PDB site
Description: Trypanosoma brucei PTR1 in complex with inhibitor NP-29
Class: oxidoreductase
Keywords: Trypanosoma brucei, pteridine reductase, oxydoreductase, inhibitor, OXIDOREDUCTASE
Deposited on 2016-04-15, released 2016-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jcxa_
  • Chain 'B':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jcxb_
  • Chain 'C':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jcxc_
  • Chain 'D':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jcxd_
  • Heterogens: NAP, CC6, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jcxA (A:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jcxA (A:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
    pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
    ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
    dgglslvha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jcxB (B:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jcxB (B:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvktvetqvaeligtnaiap
    flltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirvn
    gvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvd
    gglslvha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jcxC (C:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jcxC (C:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqktvetqvaeligtnaia
    pflltmsfaqrqssnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygir
    vngvapgvdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5jcxD (D:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jcxD (D:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
    pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
    ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
    dgglslvha