PDB entry 5jcu

View 5jcu on RCSB PDB site
Description: Crystal Structure of hGSTA1-1 with Glutathione Adduct of Phenethyl Isothiocyanate and Cystein Adduct of Phenethyl Isothiocyanate
Class: transferase
Keywords: GST, PEITC, Glutathione adduct, Cyctein adduct, TRANSFERASE
Deposited on 2016-04-15, released 2016-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jcua1, d5jcua2
  • Chain 'B':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jcub1, d5jcub2
  • Chain 'C':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jcuc1, d5jcuc2
  • Chain 'D':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jcud1, d5jcud2
  • Heterogens: GVX, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jcuA (A:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvxppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jcuB (B:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvxppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jcuC (C:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvxppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jcuD (D:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvxppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleearkifrf