PDB entry 5jcq

View 5jcq on RCSB PDB site
Description: Crystal structure of the FimH lectin domain from E.coli K12 in complex with methyl alpha-D-mannopyrannoside in spacegroup P21
Class: sugar binding protein
Keywords: type 1 pilus, FimH, UTI, bladder infection, lectin, mannose, carbohydrate, sugar binding protein
Deposited on 2016-04-15, released 2017-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein fimh
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jcqa_
  • Chain 'B':
    Compound: protein fimh
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jcqb_
  • Heterogens: MMA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5jcqA (A:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5jcqB (B:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt