PDB entry 5jcq
View 5jcq on RCSB PDB site
Description: Crystal structure of the FimH lectin domain from E.coli K12 in complex with methyl alpha-D-mannopyrannoside in spacegroup P21
Class: sugar binding protein
Keywords: type 1 pilus, FimH, UTI, bladder infection, lectin, mannose, carbohydrate, sugar binding protein
Deposited on
2016-04-15, released
2017-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated
2020-07-29, with a file datestamp of
2020-06-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.52
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein fimh
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: fimH, b4320, JW4283
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5jcqa_ - Chain 'B':
Compound: protein fimh
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: fimH, b4320, JW4283
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5jcqb_ - Heterogens: MMA, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5jcqA (A:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5jcqB (B:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt