PDB entry 5jch

View 5jch on RCSB PDB site
Description: crystal structure of chicken mda5 with 5'p 10-mer dsrna and adp-mg2+ at 2.95 a resolution (untwinned).
Deposited on 2016-04-15, released 2016-06-01
The last revision was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Melanoma differentiation associated protein-5
    Species: Gallus gallus [TaxId:9031]
    Gene: MDA5
    Database cross-references and differences (RAF-indexed):
    • Uniprot D9N195 (4-End)
      • engineered mutation (142)
  • Chain 'B':
    Compound: Melanoma differentiation associated protein-5
    Species: Gallus gallus [TaxId:9031]
    Gene: MDA5
    Database cross-references and differences (RAF-indexed):
    • Uniprot D9N195 (4-End)
      • engineered mutation (142)
  • Chain 'U':
    Compound: RNA (5'-r(p*gp*gp*up*ap*cp*gp*up*ap*cp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'V':
    Compound: RNA (5'-r(p*gp*gp*up*ap*cp*gp*up*ap*cp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'X':
    Compound: RNA (5'-r(p*gp*gp*up*ap*cp*gp*up*ap*cp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'Y':
    Compound: RNA (5'-r(p*gp*gp*up*ap*cp*gp*up*ap*cp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: ZN, ADP, MG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jchA (A:)
    gamgdltlrdyqmevakpalngeniiiclptgsgktrvavyitkdhldkkrkaseqgkvi
    vlvnkvplveqhlrkefnpflkhwyqviglsgdselkisfpevvkrydviictaqilens
    llnateedesvrlsdfsliiidqchhtqkegvynnimrrylkekiknrkqakenkplipq
    pqilgltaspgvggarsnskaeehilkicanldacrimtvkehasqlknqvkepfkktvi
    addkrrdpfreriieimqdiqkycqlypksefgsqpyeqwvireerraakeekrkervca
    ehlkkyndalqindtirmvdaynhlnnfykelkrrktaesdddeeplvskqdetdeflmr
    lfhakkkqlkelarkpeydneklmklrntlmeeftkteeprgiiftktrqsalalyhwim
    dnpkfeevgikahfligaghnsetkpmtqneqrevidkfrggsinlliattvaeegldik
    ecniviryglvtneiamvqargraradestyalvassgsgaveredvnifrenmmykair
    rvqemppeeylnkiqdfqlqsivekqmkakrdqrktykknpslitflcknchklicsged
    iqvienmhhvsvkkdfqhlyhkrenrtlqdkhadyqtnveiickdcgqvwgnmmvyrgld
    lpclkirnfvvafedkkttkeifkkwgelpiifpdfdyash
    

    Sequence, based on observed residues (ATOM records):
    >5jchA (A:)
    dltlrdyqmevakpalngeniiiclptgsgktrvavyitkdhldkkrkaseqgkvivlvn
    kvplveqhlrkefnpflkhwyqviglsgdselkisfpevvkrydviictaqilensllne
    svrlsdfsliiidqchhtqkegvynnimrrylkekiknrkqakelipqpqilgltaspgv
    ggarsnskaeehilkicanldacrimtvkehasqlknqvkepfkktviaddkrrdpfrer
    iieimqdiqkycqlypksefgsqpyeqwvireerraakeekrkervcaehlkkyndalqi
    ndtirmvdaynhlnnfykelkrrktaesddskqdetdeflmrlfhakkkqlkelarkpey
    dneklmklrntlmeeftkteeprgiiftktrqsalalyhwimdnpkfeevgikahfliga
    ghnsetkpmtqneqrevidkfrggsinlliattvaeegldikecniviryglvtneiamv
    qargraradestyalvassgsgaveredvnifrenmmykairrvqemppeeylnkiqdfq
    lqsivekqmkakrdqrkknpslitflcknchklicsgediqvienmhhvsvkkdfqhlyh
    krenqtnveiickdcgqvwgnmmvyrgldlpclkirnfvvafedtkeifkkwgelpiifp
    d
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jchB (B:)
    gamgdltlrdyqmevakpalngeniiiclptgsgktrvavyitkdhldkkrkaseqgkvi
    vlvnkvplveqhlrkefnpflkhwyqviglsgdselkisfpevvkrydviictaqilens
    llnateedesvrlsdfsliiidqchhtqkegvynnimrrylkekiknrkqakenkplipq
    pqilgltaspgvggarsnskaeehilkicanldacrimtvkehasqlknqvkepfkktvi
    addkrrdpfreriieimqdiqkycqlypksefgsqpyeqwvireerraakeekrkervca
    ehlkkyndalqindtirmvdaynhlnnfykelkrrktaesdddeeplvskqdetdeflmr
    lfhakkkqlkelarkpeydneklmklrntlmeeftkteeprgiiftktrqsalalyhwim
    dnpkfeevgikahfligaghnsetkpmtqneqrevidkfrggsinlliattvaeegldik
    ecniviryglvtneiamvqargraradestyalvassgsgaveredvnifrenmmykair
    rvqemppeeylnkiqdfqlqsivekqmkakrdqrktykknpslitflcknchklicsged
    iqvienmhhvsvkkdfqhlyhkrenrtlqdkhadyqtnveiickdcgqvwgnmmvyrgld
    lpclkirnfvvafedkkttkeifkkwgelpiifpdfdyash
    

    Sequence, based on observed residues (ATOM records):
    >5jchB (B:)
    dltlrdyqmevakpalngeniiiclptgsgktrvavyitkdhldkkrkaseqgkvivlvn
    kvplveqhlrkefnpflkhwyqviglsgdselkisfpevvkrydviictaqilensllne
    svrlsdfsliiidqchhtqkegvynnimrrylkekiknrkqakelipqpqilgltaspgv
    ggarsnskaeehilkicanldacrimtvkehasqlknqvkepfkktviaddkrrdpfrer
    iieimqdiqkycqlypksefgsqpyeqwvireerraakeekrkervcaehlkkyndalqi
    ndtirmvdaynhlnnfykelkrrktaesddskqdetdeflmrlfhakkkqlkelarkpey
    dneklmklrntlmeeftkteeprgiiftktrqsalalyhwimdnpkfeevgikahfliga
    ghnsetkpmtqneqrevidkfrggsinlliattvaeegldikecniviryglvtneiamv
    qargraradestyalvassgsgaveredvnifrenmmykairrvqemppeeylnkiqdfq
    lqsivekqmkakrdqritflcknchklicsgediqvienmhhvsvkkdfqhlyhkrenqt
    nveiickdcgqvwgnmmvyrgldlpclkirnfvvafedtkeifkkwgelpiifpd
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.