PDB entry 5jcd

View 5jcd on RCSB PDB site
Description: crystal structure of oscebip
Deposited on 2016-04-15, released 2017-02-22
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chitin elicitor-binding protein
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Gene: CEBIP, Os03g0133400, LOC_Os03g04110, OJ1006F06.19, OsJ_30068
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Chitin elicitor-binding protein
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Gene: CEBIP, Os03g0133400, LOC_Os03g04110, OJ1006F06.19, OsJ_30068
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Chitin elicitor-binding protein
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Gene: CEBIP, Os03g0133400, LOC_Os03g04110, OJ1006F06.19, OsJ_30068
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5jcdA (A:)
    anftcavasgttcksailytspnattygnlvarfntttlpdllganglpdgtlssapvaa
    nstvkipfrcrcngdvgqsdrlpiyvvqpqdgldaiarnvfnafvtyqeiaaannipdpn
    kinvsqtlwiplpcscdkeegsnvmhlaysvgkgentsaiaakygvtestlltrnkiddp
    tklqmgqildvplpv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5jcdB (B:)
    anftcavasgttcksailytspnattygnlvarfntttlpdllganglpdgtlssapvaa
    nstvkipfrcrcngdvgqsdrlpiyvvqpqdgldaiarnvfnafvtyqeiaaannipdpn
    kinvsqtlwiplpcscdkeegsnvmhlaysvgkgentsaiaakygvtestlltrnkiddp
    tklqmgqildvplpv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jcdC (C:)
    anftcavasgttcksailytspnattygnlvarfntttlpdllganglpdgtlssapvaa
    nstvkipfrcrcngdvgqsdrlpiyvvqpqdgldaiarnvfnafvtyqeiaaannipdpn
    kinvsqtlwiplpcscdkeegsnvmhlaysvgkgentsaiaakygvtestlltrnkiddp
    tklqmgqildvplpv
    

    Sequence, based on observed residues (ATOM records):
    >5jcdC (C:)
    anftcavasgttcksailytspnattygnlvarfntttlpdllganglpdgtlssapvaa
    nstvkipfrcrcngdvgqsdrlpiyvvqpqdgldaiarnvfnafvtyqeiaaannipdpn
    kinvsqtlwiplpcscdkeegsnvmhlaysvgkntsaiaakygvtestlltrnkidptkl
    qmgqildvplpv