PDB entry 5jbx

View 5jbx on RCSB PDB site
Description: Crystal structure of LiuC in complex with coenzyme A and malonic acid
Class: lyase
Keywords: Dehydratase, isovalerate, Myxococcus xanthus, lyase
Deposited on 2016-04-14, released 2016-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxybutyryl-CoA dehydratase
    Species: Myxococcus xanthus (strain DK 1622) [TaxId:246197]
    Gene: crt, MXAN_3757
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jbxa_
  • Chain 'B':
    Compound: 3-hydroxybutyryl-CoA dehydratase
    Species: Myxococcus xanthus (strain DK 1622) [TaxId:246197]
    Gene: crt, MXAN_3757
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1D5Y4 (3-260)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5jbxb1, d5jbxb2
  • Chain 'C':
    Compound: 3-hydroxybutyryl-CoA dehydratase
    Species: Myxococcus xanthus (strain DK 1622) [TaxId:246197]
    Gene: crt, MXAN_3757
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1D5Y4 (3-260)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5jbxc1, d5jbxc2
  • Heterogens: COA, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jbxA (A:)
    gphmpefkvdargpieiwtidgesrrnaisramlkelgelvtrvsssrdvravvitgagd
    kafcagadlkeratmaedevrafldglrrtfraieksdcvfiaaingaalgggtelalac
    dlrvaapaaelgltevklgiipggggtqrlarlvgpgrakdliltarrinaaeafsvgla
    nrlapeghllavayglaesvvenapiavatakhaidegtglelddalalelrkyeeilkt
    edrleglrafaekrapvykgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jbxA (A:)
    mpefkvdargpieiwtidgesrrnaisramlkelgelvtrvsssrdvravvitgagdkaf
    cagadlkeratmaedevrafldglrrtfraieksdcvfiaaingaalgggtelalacdlr
    vaapaaelgltevklgiipggggtqrlarlvgpgrakdliltarrinaaeafsvglanrl
    apeghllavayglaesvvenapiavatakhaidegtglelddalalelrkyeeilktedr
    leglrafaekrapvykgr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jbxB (B:)
    gphmpefkvdargpieiwtidgesrrnaisramlkelgelvtrvsssrdvravvitgagd
    kafcagadlkeratmaedevrafldglrrtfraieksdcvfiaaingaalgggtelalac
    dlrvaapaaelgltevklgiipggggtqrlarlvgpgrakdliltarrinaaeafsvgla
    nrlapeghllavayglaesvvenapiavatakhaidegtglelddalalelrkyeeilkt
    edrleglrafaekrapvykgr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jbxC (C:)
    gphmpefkvdargpieiwtidgesrrnaisramlkelgelvtrvsssrdvravvitgagd
    kafcagadlkeratmaedevrafldglrrtfraieksdcvfiaaingaalgggtelalac
    dlrvaapaaelgltevklgiipggggtqrlarlvgpgrakdliltarrinaaeafsvgla
    nrlapeghllavayglaesvvenapiavatakhaidegtglelddalalelrkyeeilkt
    edrleglrafaekrapvykgr