PDB entry 5jbw

View 5jbw on RCSB PDB site
Description: Crystal structure of LiuC
Class: lyase
Keywords: Dehydratase, isovalerate, Myxococcus xanthus, lyase
Deposited on 2016-04-14, released 2016-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxybutyryl-CoA dehydratase
    Species: Myxococcus xanthus (strain DK 1622) [TaxId:246197]
    Gene: crt, MXAN_3757
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1D5Y4 (2-259)
      • expression tag (1)
    Domains in SCOPe 2.07: d5jbwa1, d5jbwa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jbwA (A:)
    ghmpefkvdargpieiwtidgesrrnaisramlkelgelvtrvsssrdvravvitgagdk
    afcagadlkeratmaedevrafldglrrtfraieksdcvfiaaingaalgggtelalacd
    lrvaapaaelgltevklgiipggggtqrlarlvgpgrakdliltarrinaaeafsvglan
    rlapeghllavayglaesvvenapiavatakhaidegtglelddalalelrkyeeilkte
    drleglrafaekrapvykgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jbwA (A:)
    hmpefkvdargpieiwtidgesrrnaisramlkelgelvtrvsssrdvravvitgagdka
    fcagadlkeratmaedevrafldglrrtfraieksdcvfiaaingaalgggtelalacdl
    rvaapaaelgltevklgiipggggtqrlarlvgpgrakdliltarrinaaeafsvglanr
    lapeghllavayglaesvvenapiavatakhaidegtglelddalalelrkyeeilkted
    rleglrafaekrapvykgr